Brucella suis ZW043: IY71_13620 Help Entry IY71_13620        CDS       T03426                                  Name (GenBank) membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bsw  Brucella suis ZW043 Pathway bsw00190   Oxidative phosphorylation bsw01100   Metabolic pathways bsw02020   Two-component system Module bsw_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bsw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     IY71_13620  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     IY71_13620 Enzymes [BR:bsw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      IY71_13620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  AIN85806 UniProt:  A0AAI8EBC9 LinkDB All DBs Position 2:494739..494894 Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcgtggcttttgggcctgccgcttgcagccgcgttcgctgtgctgaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcaccactga

DBGET integrated database retrieval system