Bacillus subtilis XF-1: C663_3591 Help Entry C663_3591         CDS       T02459                                  Symbol ywlF Name (GenBank) ribose-5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism bsx  Bacillus subtilis XF-1 Pathway bsx00030   Pentose phosphate pathway bsx00051   Fructose and mannose metabolism bsx00710   Carbon fixation by Calvin cycle bsx01100   Metabolic pathways bsx01110   Biosynthesis of secondary metabolites bsx01120   Microbial metabolism in diverse environments bsx01200   Carbon metabolism bsx01230   Biosynthesis of amino acids Module bsx_M00004   Pentose phosphate pathway (Pentose phosphate cycle) bsx_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:bsx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     C663_3591 (ywlF)    00051 Fructose and mannose metabolism     C663_3591 (ywlF)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     C663_3591 (ywlF) Enzymes [BR:bsx01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      C663_3591 (ywlF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  AGE65299 LinkDB All DBs Position complement(3630085..3630534) Genome browser AA seq 149 aa AA seqDB search MKVAIASDHGGVHIRNEIKELMDELQIEYIDMGCDCGSGSVDYPDYAFPVAEKVVSGEVD RGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREI AKIWLTTEFTGGRHQTRIGKISDYEEKNL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagccattgcatcggatcatggcggcgttcacattcgaaatgaaatcaaagag ttaatggacgaattgcaaattgaatatattgatatgggctgtgactgcggcagcggctct gtcgattatccggattatgcttttccggtggccgaaaaagtggttagcggcgaagttgac agaggcattttaatttgcgggacaggcatcggcatgagcatttccgctaataaagtaaaa gggattcgctgcgcgctggcgcacgataccttcagcgcgaaggcgacgagggagcataat gacacaaacatccttgcgatgggtgaacgggtgatcggacctggtttggctcgggaaatc gcaaaaatctggctgaccactgagtttaccgggggaagacaccaaacgcgtattggaaaa atctcagattatgaagagaaaaacctgtag

DBGET integrated database retrieval system