KEGG   Bacillus subtilis subsp. subtilis BAB-1: I653_14450
Entry
I653_14450        CDS       T02520                                 
Name
(GenBank) biotin biosynthesis cytochrome
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bsy  Bacillus subtilis subsp. subtilis BAB-1
Pathway
bsy00780  Biotin metabolism
bsy01100  Metabolic pathways
bsy01240  Biosynthesis of cofactors
Module
bsy_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    I653_14450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bsy00199]
    I653_14450
Enzymes [BR:bsy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     I653_14450
Cytochrome P450 [BR:bsy00199]
 Cytochrome P450, bacteria type
  CYP107 family
   I653_14450
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-ProteinID: AGI30137
LinkDB
Position
complement(2864160..2865392)
AA seq 410 aa
MMSIAFIFEQKGENHVTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGY
EETAAILKDARFKVRTPLPESPTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRAT
ESYQPYIIETVHHLLDQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASL
IQTIDFTRSRKALTEGNHMAVQGMAYFKELIQKRKRHPQQDMISMLLKGKEKDKLTEEEA
ASTCILLAIAGHETTVNLISNSVLCLLQHPEQILKLRENPDLIGTAVEECLRYEIPTQMT
ARVASEDIDISGVTIRQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVC
LGSSLARLEAQIAINTLLQRMPSLTLADFEWRYRPLFGFRALEELPVTFE
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgatgtcgattgcttttatttttgaacagaaaggagaaaatcacgtgacaattgcatcg
tcaactgcatcttctgagtttttgaaaaacccatattctttttacgacacattgcgagct
gttcatcctatctataaagggagtttcttaaaatacccgggctggtatgtcacaggatat
gaagaaacggctgctattttgaaagatgcgagattcaaagtccgcaccccgctgcctgag
agcccaaccaaatatcaggacctttcacatgtgcaaaatcaaatgatgctgtttcagaac
cagcctgatcatagacgattgcggacgcttgccagcggagcgtttacgccgagagcgaca
gagagttatcagccgtatatcattgaaactgtccatcatttgcttgatcaagtgcaaggt
aaaaaaaagatggaggtcatttcggactttgcttttcctttagcaagctttgtcatagct
aacattataggtgtaccggaggaagatagggagcaattaaaggagtgggctgcgagtctc
attcaaacgattgattttacccggtcaagaaaggcattaacagagggcaatcatatggct
gtgcagggtatggcatatttcaaagagctgattcaaaagcgaaaacgccaccctcaacag
gatatgatcagcatgctcttgaaggggaaagaaaaggataagctgacggaagaggaggcg
gcatctacgtgcatattgctggcgatcgccggacatgagacaacggtcaatctcatcagc
aattcagtcctttgtctgctgcagcatccagaacagattttgaaactgagagaaaatcca
gatcttattggtaccgcagtcgaggaatgtttacgctatgaaatccccacgcaaatgaca
gccagagttgcgtcagaggatattgacatcagcggggtgacgatccgtcaaggagagcaa
gtctatcttttgttaggggcggctaatcgagacccaagcattttcacgaaccccgatgtc
ttcgatattacgagaagtcctaatccgcacctttcatttggtcatggccatcatgtttgt
ttagggtcctcgctggcacgattagaagcgcaaattgcgattaacactcttctgcagcgg
atgcccagccttacgctcgcggattttgaatggcggtatcggccgctttttggatttcgg
gcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system