Bradyrhizobium symbiodeficiens: CIT39_12270 Help Entry CIT39_12270       CDS       T06284                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bsym  Bradyrhizobium symbiodeficiens Pathway bsym01100   Metabolic pathways bsym01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsym00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CIT39_12270    00074 Mycolic acid biosynthesis     CIT39_12270   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CIT39_12270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AWM07148 LinkDB All DBs Position 3322743..3322982 Genome browser AA seq 79 aa AA seqDB search MSDIGERVKKIVVEHLGVEPEKVVDAASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA ETILTVGDATKFLEKNAKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacattggcgaacgggttaagaagatcgtggtcgaacaccttggtgttgaaccc gagaaggttgtcgacgcagcgagcttcatcgacgacctcggcgccgacagtctggacacc gtcgagctggtgatggcgttcgaagaagaattcggttgcgagattccggacgatgccgcg gaaacgattctcaccgtcggcgacgccacgaaatttctcgaaaagaacgcgaagagctaa

DBGET integrated database retrieval system