Brucella suis bv. 3: DK67_1388 Help Entry DK67_1388         CDS       T03266                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bsz  Brucella suis bv. 3 Pathway bsz01100   Metabolic pathways bsz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DK67_1388 (acpP)    00074 Mycolic acid biosynthesis     DK67_1388 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DK67_1388 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AIJ70860 LinkDB All DBs Position 1:1455080..1455316 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system