Bos taurus (cow): 100300510 Help Entry 100300510         CDS       T01008                                  Name (RefSeq) T cell receptor beta constant 1   KO K10785   T-cell receptor beta chain V region Organism bta  Bos taurus (cow) Pathway bta04014   Ras signaling pathway bta04015   Rap1 signaling pathway bta04020   Calcium signaling pathway bta04064   NF-kappa B signaling pathway bta04514   Cell adhesion molecules bta04612   Antigen processing and presentation bta04658   Th1 and Th2 cell differentiation bta04659   Th17 cell differentiation bta04660   T cell receptor signaling pathway bta04672   Intestinal immune network for IgA production bta04940   Type I diabetes mellitus bta05135   Yersinia infection bta05142   Chagas disease bta05144   Malaria bta05150   Staphylococcus aureus infection bta05162   Measles bta05166   Human T-cell leukemia virus 1 infection bta05169   Epstein-Barr virus infection bta05170   Human immunodeficiency virus 1 infection bta05202   Transcriptional misregulation in cancer bta05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bta05310   Asthma bta05320   Autoimmune thyroid disease bta05321   Inflammatory bowel disease bta05322   Systemic lupus erythematosus bta05323   Rheumatoid arthritis bta05330   Allograft rejection bta05332   Graft-versus-host disease bta05416   Viral myocarditis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100300510    04015 Rap1 signaling pathway     100300510    04064 NF-kappa B signaling pathway     100300510    04020 Calcium signaling pathway     100300510   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     100300510  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     100300510    04660 T cell receptor signaling pathway     100300510    04658 Th1 and Th2 cell differentiation     100300510    04659 Th17 cell differentiation     100300510    04672 Intestinal immune network for IgA production     100300510  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100300510    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100300510   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100300510    05170 Human immunodeficiency virus 1 infection     100300510    05162 Measles     100300510    05169 Epstein-Barr virus infection     100300510   09171 Infectious disease: bacterial    05135 Yersinia infection     100300510    05150 Staphylococcus aureus infection     100300510   09174 Infectious disease: parasitic    05144 Malaria     100300510    05142 Chagas disease     100300510   09163 Immune disease    05310 Asthma     100300510    05322 Systemic lupus erythematosus     100300510    05323 Rheumatoid arthritis     100300510    05320 Autoimmune thyroid disease     100300510    05321 Inflammatory bowel disease     100300510    05330 Allograft rejection     100300510    05332 Graft-versus-host disease     100300510   09166 Cardiovascular disease    05416 Viral myocarditis     100300510   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100300510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  C1-set V-set Ig_3 ig Motif Other DBs NCBI-GeneID:  100300510 NCBI-ProteinID:  XP_059741954 LinkDB All DBs Position 4:105571958..106107652 Genome browser AA seq 311 aa AA seqDB search MGFRQLCCVVLCLLGIAVCADPGITQIPKYLVMGMTDKKSLTCEQHLGHDAMYWYKQSAQ KPPELMFIHNYQKLTGNESVPSRFWSECPDSSQCRLDLNALKPQDSAIYLCASSMTGGSA EQYFGPGTKLTVLDDLSRVHPPKVAVFEPSEAEISRTQKATLVCLATGFYPDHVELTWWV NRKQVTTGVSTDPEPYKEDPARDDSRYCLSSRLRVTAAFWHNPRNHFRCQVQFHGLTDQD QWEEQNRTKPITQNISAEAWGRADCGVTSASYQQGVLSATLLYEILLGKATLYAVLVSAL VLMAMVKKKDS NT seq 936 nt NT seq  +upstreamnt  +downstreamnt atgggcttcaggcagctctgctgtgtggtcctctgtctcctgggcatagccgtctgtgcg gaccctgggatcactcagataccaaaatacctagtcatgggaatgacggacaagaaatct ttgacatgtgaacaacatctgggacatgatgctatgtactggtataaacagagcgcccag aagccgccagagctcatgttcatccacaactaccagaaactcactggaaatgagagtgtt ccaagccgcttctggtctgaatgcccagacagctctcagtgccgcctggacctgaacgcc ctgaaaccacaggactccgccatctatctctgcgccagcagtatgactgggggttctgcc gagcagtatttcggcccaggcaccaagctcacggtcttagatgatctgagccgcgtccac ccgcccaaggtggctgtgtttgaaccctcggaagcagagatctcccggacccagaaggcc acgctcgtgtgcctggccacgggcttctaccctgaccacgtggagctgacctggtgggtg aacaggaagcaggtcacgactggggtcagcacggaccctgagccctataaggaggacccc gcgagggatgactccagatactgtctgagcagccggctgagggtgaccgcggccttctgg cacaacccccgcaaccacttccgatgccaagtccagttccacgggctcacagaccaggac cagtgggaggagcagaacaggaccaagcccatcacccagaacatcagcgccgaggcctgg ggcagagcagactgtggcgtcacctccgcgtcttatcagcaaggggtcctgtctgccacc ctgctctatgagatcctgctggggaaggccaccctgtacgctgtgctggtcagcgccctg gtgctgatggccatggttaagaaaaaggattcctga

DBGET integrated database retrieval system