Bos taurus (cow): 100329210 Help Entry 100329210         CDS       T01008                                  Symbol INFAF Name (RefSeq) interferon alpha-F precursor   KO K05414   interferon alpha Organism bta  Bos taurus (cow) Pathway bta04060   Cytokine-cytokine receptor interaction bta04151   PI3K-Akt signaling pathway bta04217   Necroptosis bta04620   Toll-like receptor signaling pathway bta04621   NOD-like receptor signaling pathway bta04622   RIG-I-like receptor signaling pathway bta04623   Cytosolic DNA-sensing pathway bta04630   JAK-STAT signaling pathway bta04650   Natural killer cell mediated cytotoxicity bta04936   Alcoholic liver disease bta05152   Tuberculosis bta05160   Hepatitis C bta05161   Hepatitis B bta05162   Measles bta05163   Human cytomegalovirus infection bta05164   Influenza A bta05165   Human papillomavirus infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05168   Herpes simplex virus 1 infection bta05169   Epstein-Barr virus infection bta05170   Human immunodeficiency virus 1 infection bta05171   Coronavirus disease - COVID-19 bta05200   Pathways in cancer bta05320   Autoimmune thyroid disease bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100329210 (INFAF)    04151 PI3K-Akt signaling pathway     100329210 (INFAF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100329210 (INFAF)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100329210 (INFAF)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100329210 (INFAF)    04621 NOD-like receptor signaling pathway     100329210 (INFAF)    04622 RIG-I-like receptor signaling pathway     100329210 (INFAF)    04623 Cytosolic DNA-sensing pathway     100329210 (INFAF)    04650 Natural killer cell mediated cytotoxicity     100329210 (INFAF)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100329210 (INFAF)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100329210 (INFAF)    05161 Hepatitis B     100329210 (INFAF)    05160 Hepatitis C     100329210 (INFAF)    05171 Coronavirus disease - COVID-19     100329210 (INFAF)    05164 Influenza A     100329210 (INFAF)    05162 Measles     100329210 (INFAF)    05168 Herpes simplex virus 1 infection     100329210 (INFAF)    05163 Human cytomegalovirus infection     100329210 (INFAF)    05167 Kaposi sarcoma-associated herpesvirus infection     100329210 (INFAF)    05169 Epstein-Barr virus infection     100329210 (INFAF)    05165 Human papillomavirus infection     100329210 (INFAF)   09171 Infectious disease: bacterial    05152 Tuberculosis     100329210 (INFAF)   09163 Immune disease    05320 Autoimmune thyroid disease     100329210 (INFAF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100329210 (INFAF)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100329210 (INFAF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     100329210 (INFAF) Cytokines and neuropeptides [BR:bta04052]  Cytokines   Interferons    100329210 (INFAF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100329210 NCBI-ProteinID:  NP_001165513 UniProt:  P49876 LinkDB All DBs Position 8:complement(22707500..22708069) Genome browser AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSCNAICSLGCHLPHIHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA LPQEALGGSQLQKAQAISVLHEVTQHTSQLFSTEGFGAVWDESLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLVKKDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LQESFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccttacttctggccctgctgctgctcagctgcaacgccatctgc tctctgggttgccacctgcctcacatccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgactttgca ctcccccaggaggctctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacacctcccagctcttcagcacagagggctttggcgctgtgtgg gatgagagcctcctggacaagcttcgcgctgcactggatcagcagcttactgacctgcaa gcctgtctgaggcaggaggaggggctgcgaggggcccccctggtcaagaaggactccagc ctagctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagtttcaggagaaaggactga

DBGET integrated database retrieval system