Bos taurus (cow): 101904455 Help Entry 101904455         CDS       T01008                                  Symbol H2BK1 Name (RefSeq) histone H2B type 2-K1   KO K11252   histone H2B Organism bta  Bos taurus (cow) Pathway bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05203   Viral carcinogenesis bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101904455 (H2BK1)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101904455 (H2BK1)   09163 Immune disease    05322 Systemic lupus erythematosus     101904455 (H2BK1)   09165 Substance dependence    05034 Alcoholism     101904455 (H2BK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     101904455 (H2BK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     101904455 (H2BK1) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101904455 (H2BK1) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101904455 (H2BK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF CENP-T_C DUF6246 YscO-like Motif Other DBs NCBI-GeneID:  101904455 NCBI-ProteinID:  XP_024846715 Ensembl:  ENSBTAG00000024204 VGNC:  83624 LinkDB All DBs Position 4:complement(113782774..113785296) Genome browser AA seq 122 aa AA seqDB search MSAEHGQLQQSGGRRGRSPGDKKSRRRSRRKETYSMYIYKVLKQVHPDIGISSKAMSIMN SFVNDLFERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS SK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagcgctgagcacggacagctgcagcagtctgggggccggcgcggccggagtcctggg gacaagaagtccagaaggcgcagccggcgcaaagaaacctactccatgtacatctataag gtgctgaagcaggtgcaccccgacatcggcatctcctccaaggccatgagcatcatgaac tcgttcgtgaacgatctgtttgagcggctggccggtgaggccgcccggctggcccagtac tcgggccgaaccacactgacgtcccgggaggtccagacggccgtgcgtctgctgctgcct ggggagctggccaagcacgctgtgtccgagggcaccaaggccgtgaccaagtacacgagc tccaagtga

DBGET integrated database retrieval system