Bos taurus (cow): 104969236 Help Entry 104969236         CDS       T01008                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism bta  Bos taurus (cow) Pathway bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05203   Viral carcinogenesis bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     104969236  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     104969236   09163 Immune disease    05322 Systemic lupus erythematosus     104969236   09165 Substance dependence    05034 Alcoholism     104969236  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     104969236 Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104969236 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CBFD_NFYB_HMF CENP-S TFIID-31kDa Motif Other DBs NCBI-GeneID:  104969236 NCBI-ProteinID:  XP_059744782 LinkDB All DBs Position 7:complement(67142497..67143061) Genome browser AA seq 88 aa AA seqDB search MSGRGKGGKGRGKGGAKRHRKVLCNNIQGITKPAIRCLARSGGVKRISGLIYKETRRVLK VFLENVIRDAVTYTKHAKRKTVTAIDVV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgcggcaaaggcggcaaaggccgggggaaaggtggtgctaagcgccaccgc aaggttctgtgcaacaacatccagggcatcactaagcctgctatccgctgcctggctcgt agtggtggtgtgaagcgcatctctgggctcatttacaaggagacccgtagggtcctaaaa gtatttctggagaacgtgatccgggacgcggtcacctacaccaagcacgccaagcggaag actgtcaccgccatagatgtggtctag

DBGET integrated database retrieval system