Bos taurus (cow): 107131385 Help Entry 107131385         CDS       T01008                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism bta  Bos taurus (cow) Pathway bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05203   Viral carcinogenesis bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     107131385  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     107131385   09163 Immune disease    05322 Systemic lupus erythematosus     107131385   09165 Substance dependence    05034 Alcoholism     107131385  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     107131385   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     107131385 Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107131385 Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107131385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa CENP-T_C Motif Other DBs NCBI-GeneID:  107131385 NCBI-ProteinID:  XP_015316393 Ensembl:  ENSBTAG00000024530 LinkDB All DBs Position 27:41183652..41184055 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSCKESYSVYVYKVLKQVHLDTGISSKAM GITNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAMRLLLPGELAKQTVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccggctaaatctgctcctgcccctaaaaagggctctaaaaaagctgtgacc aaggcccagaagaaggacggcaagaagcgcaagcgcagctgcaaggagagctactccgtg tatgtgtacaaggtgctgaagcaagtccatctggacaccggcatctcctccaaggccatg ggaatcacgaactccttcgtcaacgacattttcgagcgcatcgctggcgaggcatcgcgc ctggcgcattataacaagcgctcgactatcacatccagggagatccagactgccatgcgc ttgctgctacctggggagctggccaagcagaccgtgtccgagggcactaaggctgtcacc aagtataccagctccaagtaa

DBGET integrated database retrieval system