Bos taurus (cow): 280800 Help Entry 280800            CDS       T01008                                  Symbol GAST Name (RefSeq) gastrin precursor   KO K13768   gastrin Organism bta  Bos taurus (cow) Pathway bta04081   Hormone signaling bta04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     280800 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     280800 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     280800 (GAST) Cytokines and neuropeptides [BR:bta04052]  Neuropeptides   GPCR binding    280800 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  280800 NCBI-ProteinID:  NP_776340 BGD-bta:  BT12007 Ensembl:  ENSBTAG00000017663 VGNC:  29264 UniProt:  P01352 LinkDB All DBs Position 19:41926788..41929100 Genome browser AA seq 104 aa AA seqDB search MQRLCAHVLILVLALAAFCEASWKPHSHLQDAPVAPGANRGQEPLRMNRLGPASNPRRQL GLQDPPHMVADLSKKQGPWVEEEEAAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcacatgtgctgatcttggtgctggctctggccgccttctgcgaa gcttcttggaagccccactcccacctgcaagacgcgcccgtcgctccaggggccaatagg ggccaggagccgctcaggatgaaccggctgggcccagcctcgaacccccggaggcagctg gggcttcaggatccgccacacatggtcgcagacctgtccaagaagcaggggccatgggtg gaggaagaggaagcagcatatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacatccctga

DBGET integrated database retrieval system