Bos taurus (cow): 280825 Help Entry 280825            CDS       T01008                                  Symbol IL5 Name (RefSeq) interleukin-5 precursor   KO K05428   interleukin 5 Organism bta  Bos taurus (cow) Pathway bta04060   Cytokine-cytokine receptor interaction bta04630   JAK-STAT signaling pathway bta04640   Hematopoietic cell lineage bta04657   IL-17 signaling pathway bta04658   Th1 and Th2 cell differentiation bta04660   T cell receptor signaling pathway bta04664   Fc epsilon RI signaling pathway bta04672   Intestinal immune network for IgA production bta05200   Pathways in cancer bta05310   Asthma bta05320   Autoimmune thyroid disease bta05321   Inflammatory bowel disease bta05330   Allograft rejection Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     280825 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     280825 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     280825 (IL5)    04660 T cell receptor signaling pathway     280825 (IL5)    04658 Th1 and Th2 cell differentiation     280825 (IL5)    04657 IL-17 signaling pathway     280825 (IL5)    04664 Fc epsilon RI signaling pathway     280825 (IL5)    04672 Intestinal immune network for IgA production     280825 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     280825 (IL5)   09163 Immune disease    05310 Asthma     280825 (IL5)    05320 Autoimmune thyroid disease     280825 (IL5)    05321 Inflammatory bowel disease     280825 (IL5)    05330 Allograft rejection     280825 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     280825 (IL5)    00536 Glycosaminoglycan binding proteins [BR:bta00536]     280825 (IL5) Cytokines and neuropeptides [BR:bta04052]  Cytokines   Interleukins    280825 (IL5) Glycosaminoglycan binding proteins [BR:bta00536]  Heparan sulfate / Heparin   Cytokines    280825 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  280825 NCBI-ProteinID:  NP_776347 BGD-bta:  BT30383 Ensembl:  ENSBTAG00000031235 VGNC:  30164 UniProt:  P52173 B5LVM9 LinkDB All DBs Position 7:21887391..21889791 Genome browser AA seq 134 aa AA seqDB search MRMHLHLTLVALGAAYVCANAVESTMNRLVAETLTLLSSHRTLLIGDGNLMIPTPQHTNH QLCIEEVFQGIDTLKNQTAQGDAVKKIFQNLSLIKEYIDLQKRKCGGERWRVKQFLDYLQ VFLGVINTEWTMES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagaatgcatctgcatttgactttagtagctcttggagctgcttatgtttgtgccaat gctgtagaaagtaccatgaatagactggtggcagagaccttgacactgctctcctctcat cgaactctgctgataggtgatgggaacttgatgattcctactcctcagcatacaaatcac caactgtgcattgaagaagtctttcagggaatagacacattgaagaatcaaactgcacaa ggggatgctgtgaaaaaaatattccaaaacttgtctttaataaaagaatacatagacctc caaaaaaggaagtgtggaggagaaagatggagagtgaaacaattcctagactacctgcaa gtttttcttggtgtgattaacacagagtggacaatggaaagttga

DBGET integrated database retrieval system