Bos taurus (cow): 280831 Help Entry 280831            CDS       T01008                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism bta  Bos taurus (cow) Pathway bta01522   Endocrine resistance bta04010   MAPK signaling pathway bta04012   ErbB signaling pathway bta04024   cAMP signaling pathway bta04137   Mitophagy - animal bta04210   Apoptosis bta04310   Wnt signaling pathway bta04380   Osteoclast differentiation bta04510   Focal adhesion bta04530   Tight junction bta04620   Toll-like receptor signaling pathway bta04621   NOD-like receptor signaling pathway bta04625   C-type lectin receptor signaling pathway bta04657   IL-17 signaling pathway bta04658   Th1 and Th2 cell differentiation bta04659   Th17 cell differentiation bta04660   T cell receptor signaling pathway bta04662   B cell receptor signaling pathway bta04668   TNF signaling pathway bta04722   Neurotrophin signaling pathway bta04912   GnRH signaling pathway bta04915   Estrogen signaling pathway bta04921   Oxytocin signaling pathway bta04926   Relaxin signaling pathway bta04932   Non-alcoholic fatty liver disease bta04933   AGE-RAGE signaling pathway in diabetic complications bta05030   Cocaine addiction bta05031   Amphetamine addiction bta05132   Salmonella infection bta05133   Pertussis bta05135   Yersinia infection bta05140   Leishmaniasis bta05142   Chagas disease bta05161   Hepatitis B bta05162   Measles bta05166   Human T-cell leukemia virus 1 infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05169   Epstein-Barr virus infection bta05170   Human immunodeficiency virus 1 infection bta05171   Coronavirus disease - COVID-19 bta05200   Pathways in cancer bta05203   Viral carcinogenesis bta05207   Chemical carcinogenesis - receptor activation bta05208   Chemical carcinogenesis - reactive oxygen species bta05210   Colorectal cancer bta05211   Renal cell carcinoma bta05224   Breast cancer bta05231   Choline metabolism in cancer bta05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bta05321   Inflammatory bowel disease bta05323   Rheumatoid arthritis bta05417   Lipid and atherosclerosis bta05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     280831 (JUN)    04012 ErbB signaling pathway     280831 (JUN)    04310 Wnt signaling pathway     280831 (JUN)    04668 TNF signaling pathway     280831 (JUN)    04024 cAMP signaling pathway     280831 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     280831 (JUN)   09143 Cell growth and death    04210 Apoptosis     280831 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     280831 (JUN)    04530 Tight junction     280831 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     280831 (JUN)    04621 NOD-like receptor signaling pathway     280831 (JUN)    04625 C-type lectin receptor signaling pathway     280831 (JUN)    04660 T cell receptor signaling pathway     280831 (JUN)    04658 Th1 and Th2 cell differentiation     280831 (JUN)    04659 Th17 cell differentiation     280831 (JUN)    04657 IL-17 signaling pathway     280831 (JUN)    04662 B cell receptor signaling pathway     280831 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     280831 (JUN)    04915 Estrogen signaling pathway     280831 (JUN)    04921 Oxytocin signaling pathway     280831 (JUN)    04926 Relaxin signaling pathway     280831 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     280831 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     280831 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     280831 (JUN)    05207 Chemical carcinogenesis - receptor activation     280831 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     280831 (JUN)    05203 Viral carcinogenesis     280831 (JUN)    05231 Choline metabolism in cancer     280831 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     280831 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     280831 (JUN)    05211 Renal cell carcinoma     280831 (JUN)    05224 Breast cancer     280831 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     280831 (JUN)    05170 Human immunodeficiency virus 1 infection     280831 (JUN)    05161 Hepatitis B     280831 (JUN)    05171 Coronavirus disease - COVID-19     280831 (JUN)    05162 Measles     280831 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     280831 (JUN)    05169 Epstein-Barr virus infection     280831 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     280831 (JUN)    05135 Yersinia infection     280831 (JUN)    05133 Pertussis     280831 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     280831 (JUN)    05142 Chagas disease     280831 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     280831 (JUN)    05321 Inflammatory bowel disease     280831 (JUN)   09165 Substance dependence    05030 Cocaine addiction     280831 (JUN)    05031 Amphetamine addiction     280831 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     280831 (JUN)    05418 Fluid shear stress and atherosclerosis     280831 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     280831 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     280831 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     280831 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bta03000]     280831 (JUN) Transcription factors [BR:bta03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     280831 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha TFIIA ATG16 DUF3450 FlaC_arch NYD-SP28_assoc Motif Other DBs NCBI-GeneID:  280831 NCBI-ProteinID:  NP_001071295 BGD-bta:  BT10059 VGNC:  30386 UniProt:  Q08DH1 LinkDB All DBs Position 3:87265962..87268009 Genome browser AA seq 303 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVYANLSNFNPGSLSSGGGAPSYGAAGLAFPAQPQQQQQQPPQPP HHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASK CRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQL QTF NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tctgagagcggcgcctacggctacagtaaccccaagattctgaagcagagcatgaccctg aatctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactccgacctc ctcacctctcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctaatc atacagtccagcaacgggcatatcaccaccacgccgacccctacccagttcctgtgcccc aagaacgtgacggacgagcaggagggattcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtctacgccaac ctcagcaacttcaaccccggctcgctgagcagcggcggcggggcaccctcctacggcgcg gctggcctggcctttcccgcgcagccccagcagcagcagcagcaaccgccgcagccgccg caccacctgccccagcagatccccgtgcagcacccgcggctgcaggccctgaaggaggag ccgcagacggtgcccgagatgcccggggaaacgccgcccctgtcccccatcgacatggag tcccaggagcggatcaaggcagagaggaagcgcatgaggaaccgcatcgctgcctccaag tgccggaaaaggaagctggagaggatcgcgcggctggaggaaaaagtgaaaaccttgaaa gcgcagaactcggagctggcgtccacggccaatatgctcagggaacaggtggcccagctt aaacagaaagtcatgaaccacgttaacagcgggtgccaactcatgctaacgcagcagttg caaacgttttga

DBGET integrated database retrieval system