Bos taurus (cow): 281040 Help Entry 281040            CDS       T01008                                  Symbol CAV1 Name (RefSeq) caveolin-1   KO K06278   caveolin 1 Organism bta  Bos taurus (cow) Pathway bta04144   Endocytosis bta04510   Focal adhesion bta05020   Prion disease bta05100   Bacterial invasion of epithelial cells bta05205   Proteoglycans in cancer bta05416   Viral myocarditis bta05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     281040 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     281040 (CAV1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     281040 (CAV1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     281040 (CAV1)   09164 Neurodegenerative disease    05020 Prion disease     281040 (CAV1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     281040 (CAV1)    05416 Viral myocarditis     281040 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     281040 (CAV1) Membrane trafficking [BR:bta04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     281040 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  281040 NCBI-ProteinID:  NP_776429 BGD-bta:  BT10178 Ensembl:  ENSBTAG00000017869 VGNC:  26799 UniProt:  P79132 LinkDB All DBs Position 4:complement(51865751..51901396) Genome browser AA seq 178 aa AA seqDB search MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMAEEMNEKQVYDAHTKEIDLVNRDPKHLN DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRINTQKEI NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgtcggggggcaaatacgtagactcagagggacatctctacactgttcccatccgggaa cagggcaacatctacaagcccaacaacaaggctatggcagaggaaatgaacgagaagcaa gtgtacgacgcgcacaccaaggagatagatctggtcaaccgcgaccccaagcatctcaac gacgacgtggtcaagattgattttgaagatgtgattgcagaaccagaaggaacacacagt ttcgatggcatctggaaggccagcttcaccaccttcactgtgacaaagtactggttttac cgtttgctgtctgccctctttggcatcccaatggcactcatctggggcatttactttgcc attctctctttcctgcacatctgggcagttgtaccatgcattaagagtttcctgattgag attcagtgcatcagccgtgtctattccatctacgtccacaccttctgtgacccgctgttt gaggctattggcaaaatattcagcaatatccgcatcaacacgcagaaagaaatataa

DBGET integrated database retrieval system