Bos taurus (cow): 281191 Help Entry 281191            CDS       T01008                                  Symbol GHRH Name (RefSeq) somatoliberin precursor   KO K05260   growth hormone-releasing hormone Organism bta  Bos taurus (cow) Pathway bta04080   Neuroactive ligand-receptor interaction bta04081   Hormone signaling bta04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     281191 (GHRH)    04081 Hormone signaling     281191 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     281191 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     281191 (GHRH) Cytokines and neuropeptides [BR:bta04052]  Neuropeptides   GPCR binding    281191 (GHRH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_2 Ret2_MD Motif Other DBs NCBI-GeneID:  281191 NCBI-ProteinID:  NP_847895 BGD-bta:  BT10035 Ensembl:  ENSBTAG00000012710 VGNC:  29349 UniProt:  P63292 LinkDB All DBs Position 13:complement(66207181..66216486) Genome browser AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSHGSLPSQPLRIPRYADAIFTNSYRKVLGQLSARKLLQDIMNRQ QGERNQEQGAKVRLGRQVDGVWTDQQQMALESTLVSLLQERRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgaccctcaccctcagcagcggctcccacggttcc ctgccttcccagcctctcaggattccacggtacgcagatgccatcttcactaacagctac cggaaggttctgggccagctgtctgcccgcaagctactccaggatatcatgaacaggcag cagggagagagaaaccaggagcaaggagcaaaggtacggcttggccgtcaggtggacggc gtgtggacagaccaacagcagatggcactggagagcaccttggtgagcctgctgcaggag cgcaggaactcccaaggatga

DBGET integrated database retrieval system