Bos taurus (cow): 281250 Help Entry 281250            CDS       T01008                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha precursor   KO K04383   interleukin 1 alpha Organism bta  Bos taurus (cow) Pathway bta04010   MAPK signaling pathway bta04060   Cytokine-cytokine receptor interaction bta04217   Necroptosis bta04218   Cellular senescence bta04380   Osteoclast differentiation bta04640   Hematopoietic cell lineage bta04932   Non-alcoholic fatty liver disease bta04933   AGE-RAGE signaling pathway in diabetic complications bta04940   Type I diabetes mellitus bta05010   Alzheimer disease bta05020   Prion disease bta05022   Pathways of neurodegeneration - multiple diseases bta05133   Pertussis bta05140   Leishmaniasis bta05152   Tuberculosis bta05162   Measles bta05164   Influenza A bta05321   Inflammatory bowel disease bta05323   Rheumatoid arthritis bta05332   Graft-versus-host disease bta05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     281250 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     281250 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     281250 (IL1A)    04218 Cellular senescence     281250 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     281250 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     281250 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     281250 (IL1A)    05162 Measles     281250 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     281250 (IL1A)    05152 Tuberculosis     281250 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     281250 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     281250 (IL1A)    05321 Inflammatory bowel disease     281250 (IL1A)    05332 Graft-versus-host disease     281250 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     281250 (IL1A)    05020 Prion disease     281250 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     281250 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     281250 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     281250 (IL1A)    04932 Non-alcoholic fatty liver disease     281250 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     281250 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     281250 (IL1A) Cytokines and neuropeptides [BR:bta04052]  Cytokines   Interleukins    281250 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1_propep IL1 DUF4937 Motif Other DBs NCBI-GeneID:  281250 NCBI-ProteinID:  NP_776517 BGD-bta:  BT10680 Ensembl:  ENSBTAG00000010349 VGNC:  30130 UniProt:  P08831 LinkDB All DBs Position 11:complement(46482553..46493533) Genome browser AA seq 268 aa AA seqDB search MAKVPDLFEDLKNCYSENEDYSSEIDHLSLNQKSFYDASYEPLREDQMNKFMSLDTSETS KTSKLSFKENVVMVAASGKILKKRRLSLNQFITDDDLEAIANNTEEEIIKPRSAHYSFQS NVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQL PVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPK LFIATKQEKLVHMASGPPSITDFQILEK NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgaaaatgaagac tacagttctgaaattgaccacctctctctcaatcagaagtccttctatgatgcaagctat gagccacttcgtgaggaccagatgaataagtttatgtccctggatacctcggaaacctct aagacatccaagcttagcttcaaggagaatgtggtgatggtggcagccagtgggaagatt ctgaagaagagacggttgagtttaaatcagttcatcaccgatgatgacctggaagccatt gccaataatacagaagaagaaatcatcaagcccagatcagcacattacagcttccagagt aacgtgaaatacaactttatgagagtcatccaccaggaatgcatcctgaacgacgccctc aatcaaagtataattcgagatatgtcaggtccatacctgacggctactacattaaataat ctggaggaggcagtgaaatttgacatggttgcttatgtatcagaagaggattctcagctt cctgtgactctaagaatctcaaaaactcaactgtttgtgagtgctcaaaatgaagacgaa cccgtcttgctaaaggagatgcctgagacacccaaaatcatcaaagatgagaccaacctc ctcttcttctgggaaaagcatggctctatggactacttcaaatcagttgcccatccaaag ttgtttattgccacaaagcaagaaaaattggtgcacatggcaagtgggccgccctcgatc actgactttcagatattggaaaaatag

DBGET integrated database retrieval system