Bos taurus (cow): 282143 Help Entry 282143            CDS       T01008                                  Symbol APLN Name (RefSeq) apelin precursor   KO K05225   apelin Organism bta  Bos taurus (cow) Pathway bta04080   Neuroactive ligand-receptor interaction bta04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     282143 (APLN)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     282143 (APLN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     282143 (APLN) Cytokines and neuropeptides [BR:bta04052]  Neuropeptides   GPCR binding    282143 (APLN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  282143 NCBI-ProteinID:  NP_776928 BGD-bta:  BT10310 VGNC:  26017 UniProt:  Q9TUI9 LinkDB All DBs Position X:complement(13687958..13697147) Genome browser AA seq 77 aa AA seqDB search MNLRRCVQALLLLWLCLSAVCGGPLLQTSDGKEMEEGTIRYLVQPRGPRSGPGPWQGGRR KFRRQRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaatctgcggcgctgcgtgcaggcgctcctgctgctctggctctgcctgagcgcggtg tgcggaggacccctgctgcagacttctgacgggaaggagatggaagaaggcaccatccga tacctggtgcagcccagggggccgaggagcggcccaggcccctggcagggaggtcggagg aagttccggcgccagcggccacgcctctcccacaagggtcccatgcctttctga

DBGET integrated database retrieval system