Bos taurus (cow): 282170 Help Entry 282170            CDS       T01008                                  Symbol CCL3 Name (RefSeq) C-C motif chemokine 3 precursor   KO K05408   C-C motif chemokine 3 Organism bta  Bos taurus (cow) Pathway bta04060   Cytokine-cytokine receptor interaction bta04061   Viral protein interaction with cytokine and cytokine receptor bta04062   Chemokine signaling pathway bta04620   Toll-like receptor signaling pathway bta05142   Chagas disease bta05163   Human cytomegalovirus infection bta05323   Rheumatoid arthritis bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     282170 (CCL3)    04061 Viral protein interaction with cytokine and cytokine receptor     282170 (CCL3)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     282170 (CCL3)    04062 Chemokine signaling pathway     282170 (CCL3)  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     282170 (CCL3)   09174 Infectious disease: parasitic    05142 Chagas disease     282170 (CCL3)   09163 Immune disease    05323 Rheumatoid arthritis     282170 (CCL3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     282170 (CCL3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     282170 (CCL3)    00536 Glycosaminoglycan binding proteins [BR:bta00536]     282170 (CCL3) Cytokines and neuropeptides [BR:bta04052]  Cytokines   Chemokines    282170 (CCL3) Glycosaminoglycan binding proteins [BR:bta00536]  Heparan sulfate / Heparin   Chemokines    282170 (CCL3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  282170 NCBI-ProteinID:  NP_776936 BGD-bta:  BT10153 UniProt:  Q8SQA6 LinkDB All DBs Position 19:14360209..14361720 Genome browser AA seq 93 aa AA seqDB search MKVAVAALAVLLCAMALCSQVFSAPFGADTPTACCFSYVARQLSRKIVADYFETSSQCSK PGVIFQTKKGRQVCANPTEDWVQEYITDLELNA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcgccgtggctgctctcgccgttctcctctgcgccatggccctctgcagccag gtcttctcggcaccatttggcgctgacaccccaacggcctgctgcttctcctatgtcgcc cggcagctttctcgcaaaatcgtagctgactattttgagaccagcagccagtgctccaag cctggtgtcatcttccagaccaaaaaaggccggcaggtctgtgccaaccccactgaggac tgggtccaggaatacatcaccgacctggagctgaatgcctga

DBGET integrated database retrieval system