Bos taurus (cow): 282291 Help Entry 282291            CDS       T01008                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism bta  Bos taurus (cow) Pathway bta04024   cAMP signaling pathway bta04062   Chemokine signaling pathway bta04064   NF-kappa B signaling pathway bta04210   Apoptosis bta04380   Osteoclast differentiation bta04620   Toll-like receptor signaling pathway bta04621   NOD-like receptor signaling pathway bta04622   RIG-I-like receptor signaling pathway bta04623   Cytosolic DNA-sensing pathway bta04625   C-type lectin receptor signaling pathway bta04657   IL-17 signaling pathway bta04658   Th1 and Th2 cell differentiation bta04659   Th17 cell differentiation bta04660   T cell receptor signaling pathway bta04662   B cell receptor signaling pathway bta04668   TNF signaling pathway bta04722   Neurotrophin signaling pathway bta04920   Adipocytokine signaling pathway bta04926   Relaxin signaling pathway bta04931   Insulin resistance bta04936   Alcoholic liver disease bta05132   Salmonella infection bta05134   Legionellosis bta05135   Yersinia infection bta05140   Leishmaniasis bta05142   Chagas disease bta05145   Toxoplasmosis bta05160   Hepatitis C bta05161   Hepatitis B bta05162   Measles bta05163   Human cytomegalovirus infection bta05164   Influenza A bta05166   Human T-cell leukemia virus 1 infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05168   Herpes simplex virus 1 infection bta05169   Epstein-Barr virus infection bta05170   Human immunodeficiency virus 1 infection bta05171   Coronavirus disease - COVID-19 bta05200   Pathways in cancer bta05203   Viral carcinogenesis bta05208   Chemical carcinogenesis - reactive oxygen species bta05215   Prostate cancer bta05220   Chronic myeloid leukemia bta05222   Small cell lung cancer bta05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     282291 (NFKBIA)    04668 TNF signaling pathway     282291 (NFKBIA)    04024 cAMP signaling pathway     282291 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     282291 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     282291 (NFKBIA)    04621 NOD-like receptor signaling pathway     282291 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     282291 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     282291 (NFKBIA)    04625 C-type lectin receptor signaling pathway     282291 (NFKBIA)    04660 T cell receptor signaling pathway     282291 (NFKBIA)    04658 Th1 and Th2 cell differentiation     282291 (NFKBIA)    04659 Th17 cell differentiation     282291 (NFKBIA)    04657 IL-17 signaling pathway     282291 (NFKBIA)    04662 B cell receptor signaling pathway     282291 (NFKBIA)    04062 Chemokine signaling pathway     282291 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     282291 (NFKBIA)    04926 Relaxin signaling pathway     282291 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     282291 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     282291 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     282291 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     282291 (NFKBIA)    05203 Viral carcinogenesis     282291 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     282291 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     282291 (NFKBIA)    05215 Prostate cancer     282291 (NFKBIA)    05222 Small cell lung cancer     282291 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     282291 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     282291 (NFKBIA)    05161 Hepatitis B     282291 (NFKBIA)    05160 Hepatitis C     282291 (NFKBIA)    05171 Coronavirus disease - COVID-19     282291 (NFKBIA)    05164 Influenza A     282291 (NFKBIA)    05162 Measles     282291 (NFKBIA)    05168 Herpes simplex virus 1 infection     282291 (NFKBIA)    05163 Human cytomegalovirus infection     282291 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     282291 (NFKBIA)    05169 Epstein-Barr virus infection     282291 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     282291 (NFKBIA)    05135 Yersinia infection     282291 (NFKBIA)    05134 Legionellosis     282291 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     282291 (NFKBIA)    05140 Leishmaniasis     282291 (NFKBIA)    05142 Chagas disease     282291 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     282291 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     282291 (NFKBIA)    04931 Insulin resistance     282291 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bta03000]     282291 (NFKBIA)    04131 Membrane trafficking [BR:bta04131]     282291 (NFKBIA) Transcription factors [BR:bta03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     282291 (NFKBIA) Membrane trafficking [BR:bta04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     282291 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  282291 NCBI-ProteinID:  NP_001039333 BGD-bta:  BT10682 Ensembl:  ENSBTAG00000016683 VGNC:  32045 UniProt:  Q8WNW7 LinkDB All DBs Position 21:complement(45639614..45643009) Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcactta gccatcatccatgaagagaaggcgctgaccatggaagtggtccgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctgcga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccgggggacccagcacctccactccatcctgcaggccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctattgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacgtggggccgc cccagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagacactg ccggagagcgaggatgaggagagctatgacaccgaatcagagttcacagaggacgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system