Bos taurus (cow): 282321 Help Entry 282321            CDS       T01008                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism bta  Bos taurus (cow) Pathway bta04010   MAPK signaling pathway bta04020   Calcium signaling pathway bta04022   cGMP-PKG signaling pathway bta04114   Oocyte meiosis bta04218   Cellular senescence bta04310   Wnt signaling pathway bta04360   Axon guidance bta04370   VEGF signaling pathway bta04380   Osteoclast differentiation bta04625   C-type lectin receptor signaling pathway bta04650   Natural killer cell mediated cytotoxicity bta04658   Th1 and Th2 cell differentiation bta04659   Th17 cell differentiation bta04660   T cell receptor signaling pathway bta04662   B cell receptor signaling pathway bta04720   Long-term potentiation bta04724   Glutamatergic synapse bta04921   Oxytocin signaling pathway bta04922   Glucagon signaling pathway bta04924   Renin secretion bta05010   Alzheimer disease bta05014   Amyotrophic lateral sclerosis bta05020   Prion disease bta05022   Pathways of neurodegeneration - multiple diseases bta05031   Amphetamine addiction bta05152   Tuberculosis bta05163   Human cytomegalovirus infection bta05166   Human T-cell leukemia virus 1 infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05170   Human immunodeficiency virus 1 infection bta05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     282321 (PPP3R1)    04022 cGMP-PKG signaling pathway     282321 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     282321 (PPP3R1)    04660 T cell receptor signaling pathway     282321 (PPP3R1)    04658 Th1 and Th2 cell differentiation     282321 (PPP3R1)    04659 Th17 cell differentiation     282321 (PPP3R1)    04662 B cell receptor signaling pathway     282321 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     282321 (PPP3R1)    04921 Oxytocin signaling pathway     282321 (PPP3R1)    04924 Renin secretion     282321 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     282321 (PPP3R1)    04720 Long-term potentiation     282321 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     282321 (PPP3R1)    04380 Osteoclast differentiation     282321 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     282321 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     282321 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     282321 (PPP3R1)    05163 Human cytomegalovirus infection     282321 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     282321 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     282321 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     282321 (PPP3R1)    05014 Amyotrophic lateral sclerosis     282321 (PPP3R1)    05020 Prion disease     282321 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     282321 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     282321 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     282321 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bta01009]     282321 (PPP3R1) Protein phosphatases and associated proteins [BR:bta01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      282321 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  282321 NCBI-ProteinID:  NP_777008 BGD-bta:  BT30320 Ensembl:  ENSBTAG00000010619 VGNC:  50247 UniProt:  P63099 Structure PDBPDBj LinkDB All DBs Position 11:complement(66605841..66667488) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcagatgaaatt aaaaggctaggaaagagatttaagaagctcgatttggacaattctggttctttgagtgtg gaagagttcatgtctctacctgagttacaacagaatcccttagtacagcgagtaatagat atattcgacacagatgggaatggagaagtagactttaaagagttcattgagggagtctct cagttcagtgtcaaaggagataaggaacagaagttgaggtttgctttccgtatctatgac atggataaagacggctatatttccaatggggaactcttccaggtgctaaagatgatggtg gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca gataaggatggggatggaagaatatcctttgaagaattctgtgctgttgtaggcggccta gatatccacaaaaagatggtggtagacgtgtga

DBGET integrated database retrieval system