Bos taurus (cow): 282380 Help Entry 282380            CDS       T01008                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism bta  Bos taurus (cow) Pathway bta04814   Motor proteins bta05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bta00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     282380 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     282380 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bta03037]     282380 (DYNLT1)    04812 Cytoskeleton proteins [BR:bta04812]     282380 (DYNLT1) Cilium and associated proteins [BR:bta03037]  Motile cilia and associated proteins   Dynein arm    282380 (DYNLT1) Cytoskeleton proteins [BR:bta04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      282380 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  282380 NCBI-ProteinID:  NP_777045 UniProt:  P63171 LinkDB All DBs Position 9:complement(95047826..95055238) Genome browser AA seq 113 aa AA seqDB search MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggccgccgaggagactgcttttgttgttgatgaagtgagcaacatc gtaaaagaggccatagaaagcgccatcggtggcaacgcctatcagcacagcaaagtcaat cagtggaccacaaacgtagtggagcagaccttaagccaactcaccaagctggggaagcca tttaagtacatcgtgacctgtgtgatcatgcagaagaatggagcgggcctgcacacggca agctcgtgcttctgggacagctccaccgatgggagctgcaccgtgcgatgggagaacaag accatgtactgcatcgtcagcgccttcggcctgtccatctga

DBGET integrated database retrieval system