Bos taurus (cow): 282466 Help Entry 282466            CDS       T01008                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism bta  Bos taurus (cow) Pathway bta04382   Cornified envelope formation bta05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     282466 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     282466 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     282466 (S100A10) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of microglial cells    282466 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  282466 NCBI-ProteinID:  NP_777075 BGD-bta:  BT12326 Ensembl:  ENSBTAG00000015147 VGNC:  34237 UniProt:  P60902 LinkDB All DBs Position 3:18762488..18773422 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggagcacgccatggaaaccatgatgttcacatttcacaaatttgca ggtgataaaggttacttaacaaaggaagacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctggac cagtgtcgagacggcaaagtgggcttccagagcttcttttcgctaatcgctgggctcacc atcgcatgcaatgactattttgtagtacacatgaagcagaaggggaagaagtag

DBGET integrated database retrieval system