Bos taurus (cow): 282601 Help Entry 282601            CDS       T01008                                  Symbol ARF2 Name (RefSeq) ADP-ribosylation factor 2   KO K07937   ADP-ribosylation factor 1/2 Organism bta  Bos taurus (cow) Pathway bta04072   Phospholipase D signaling pathway bta04144   Endocytosis bta05132   Salmonella infection bta05134   Legionellosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     282601 (ARF2)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     282601 (ARF2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     282601 (ARF2)    05134 Legionellosis     282601 (ARF2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     282601 (ARF2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     282601 (ARF2)    04031 GTP-binding proteins [BR:bta04031]     282601 (ARF2) Membrane trafficking [BR:bta04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     282601 (ARF2)   Arf GTPases and associated proteins    Arf GTPases     282601 (ARF2)  Endosome - Golgi transport     282601 (ARF2) Exosome [BR:bta04147]  Exosomal proteins   Proteins found in most exosomes    282601 (ARF2) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     282601 (ARF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc SRPRB G-alpha Ras Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K RsgA_GTPase cobW FLAD1_M Csa3_N Motif Other DBs NCBI-GeneID:  282601 NCBI-ProteinID:  NP_777114 BGD-bta:  BT10943 Ensembl:  ENSBTAG00000006785 UniProt:  P84081 LinkDB All DBs Position 19:45605693..45624231 Genome browser AA seq 181 aa AA seqDB search MGNVFEKLFKSLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELTRMLAEDELRDAV LLVFVNKQDLPNAMNAAEITDKLGLHSLRQRNWYIQATCATSGDGLYEGLDWLSNQLKNQ K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggggaacgtttttgaaaaattgtttaaaagtctctttgggaaaaaggagatgcggatt cttatggtgggtttggatgccgctggaaaaaccaccatcttgtacaaactgaagctggga gagattgtgactaccatccccacgataggtttcaacgtggagacagtagaatataaaaac atcagcttcacagtctgggatgtcggcggccaggacaaaatcagacctctgtggcgacat tatttccagaacacacaaggtctgattttcgtggtcgacagtaatgacagagagcgggtc aatgaagcccgagaagaactaaccagaatgttagctgaagacgagctcagagatgcggtc ttattggtgtttgtaaataaacaggatcttcccaatgctatgaacgcagcagagataaca gacaagcttggcttacattccctccgccagagaaactggtacattcaggctacttgcgcc accagtggagatgggctttatgaaggcctggactggctctccaaccagctcaaaaaccag aagtga

DBGET integrated database retrieval system