Bos taurus (cow): 282691 Help Entry 282691            CDS       T01008                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism bta  Bos taurus (cow) Pathway bta03410   Base excision repair bta04140   Autophagy - animal bta04217   Necroptosis bta04613   Neutrophil extracellular trap formation Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     282691 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     282691 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     282691 (HMGB1)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     282691 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     282691 (HMGB1)    03400 DNA repair and recombination proteins [BR:bta03400]     282691 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     282691 (HMGB1) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     282691 (HMGB1) DNA repair and recombination proteins [BR:bta03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      282691 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      282691 (HMGB1) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    282691 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 NOA36 HMG_box_5 Nop14 Motif Other DBs NCBI-GeneID:  282691 NCBI-ProteinID:  NP_788785 BGD-bta:  BT10780 Ensembl:  ENSBTAG00000018103 VGNC:  53816 UniProt:  P10103 LinkDB All DBs Position 12:30209575..30334067 Genome browser AA seq 215 aa AA seqDB search MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEEEEEDDDDE NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattctttgtg caaacttgccgggaggagcacaagaagaagcacccggatgcttctgtcaacttctcagag ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt gaagacatggcaaaggcggacaaggcccgttatgaaagagaaatgaaaacttatattcct cctaaaggggaaacaaaaaagaagttcaaggatcccaatgcacctaagaggcctccttcg gcctttttcttgttttgttctgagtatcgtccaaaaatcaaaggcgaacatcctggcctg tctattggtgatgttgcaaagaaactgggagagatgtggaataacactgctgcggatgat aagcagccttatgagaagaaggctgctaagctgaaggaaaagtatgaaaaggatattgcc gcataccgagctaaagggaaacctgatgcagcaaaaaagggagttgtcaaggctgaaaag agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggaa gaagatgaagaggatgaggaggaggaagaagatgatgatgatgaataa

DBGET integrated database retrieval system