Bos taurus (cow): 338049 Help Entry 338049            CDS       T01008                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism bta  Bos taurus (cow) Pathway bta04014   Ras signaling pathway bta04015   Rap1 signaling pathway bta04022   cGMP-PKG signaling pathway bta04024   cAMP signaling pathway bta04062   Chemokine signaling pathway bta04071   Sphingolipid signaling pathway bta04072   Phospholipase D signaling pathway bta04081   Hormone signaling bta04144   Endocytosis bta04150   mTOR signaling pathway bta04270   Vascular smooth muscle contraction bta04310   Wnt signaling pathway bta04350   TGF-beta signaling pathway bta04360   Axon guidance bta04510   Focal adhesion bta04517   IgSF CAM signaling bta04519   Cadherin signaling bta04520   Adherens junction bta04530   Tight junction bta04611   Platelet activation bta04621   NOD-like receptor signaling pathway bta04625   C-type lectin receptor signaling pathway bta04660   T cell receptor signaling pathway bta04670   Leukocyte transendothelial migration bta04722   Neurotrophin signaling pathway bta04810   Regulation of actin cytoskeleton bta04921   Oxytocin signaling pathway bta04928   Parathyroid hormone synthesis, secretion and action bta04972   Pancreatic secretion bta05100   Bacterial invasion of epithelial cells bta05132   Salmonella infection bta05133   Pertussis bta05135   Yersinia infection bta05152   Tuberculosis bta05163   Human cytomegalovirus infection bta05200   Pathways in cancer bta05203   Viral carcinogenesis bta05205   Proteoglycans in cancer bta05206   MicroRNAs in cancer bta05210   Colorectal cancer bta05417   Lipid and atherosclerosis bta05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     338049 (RHOA)    04015 Rap1 signaling pathway     338049 (RHOA)    04310 Wnt signaling pathway     338049 (RHOA)    04350 TGF-beta signaling pathway     338049 (RHOA)    04072 Phospholipase D signaling pathway     338049 (RHOA)    04071 Sphingolipid signaling pathway     338049 (RHOA)    04024 cAMP signaling pathway     338049 (RHOA)    04022 cGMP-PKG signaling pathway     338049 (RHOA)    04150 mTOR signaling pathway     338049 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     338049 (RHOA)    04517 IgSF CAM signaling     338049 (RHOA)    04519 Cadherin signaling     338049 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     338049 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     338049 (RHOA)    04520 Adherens junction     338049 (RHOA)    04530 Tight junction     338049 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     338049 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     338049 (RHOA)    04621 NOD-like receptor signaling pathway     338049 (RHOA)    04625 C-type lectin receptor signaling pathway     338049 (RHOA)    04660 T cell receptor signaling pathway     338049 (RHOA)    04670 Leukocyte transendothelial migration     338049 (RHOA)    04062 Chemokine signaling pathway     338049 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     338049 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     338049 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     338049 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     338049 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     338049 (RHOA)   09158 Development and regeneration    04360 Axon guidance     338049 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     338049 (RHOA)    05206 MicroRNAs in cancer     338049 (RHOA)    05205 Proteoglycans in cancer     338049 (RHOA)    05203 Viral carcinogenesis     338049 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     338049 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     338049 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     338049 (RHOA)    05135 Yersinia infection     338049 (RHOA)    05133 Pertussis     338049 (RHOA)    05152 Tuberculosis     338049 (RHOA)    05100 Bacterial invasion of epithelial cells     338049 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     338049 (RHOA)    05418 Fluid shear stress and atherosclerosis     338049 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     338049 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     338049 (RHOA)    04031 GTP-binding proteins [BR:bta04031]     338049 (RHOA) Membrane trafficking [BR:bta04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     338049 (RHOA) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    338049 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    338049 (RHOA)   Exosomal proteins of colorectal cancer cells    338049 (RHOA)   Exosomal proteins of bladder cancer cells    338049 (RHOA) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     338049 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  338049 NCBI-ProteinID:  NP_788818 BGD-bta:  BT11858 Ensembl:  ENSBTAG00000004279 VGNC:  33943 UniProt:  P61585 LinkDB All DBs Position 22:50701226..50751133 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgcttattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttatgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata ctgatgtgtttctccattgatagccctgatagtttagaaaacataccagaaaaatggact ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaacgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system