Bos taurus (cow): 338058 Help Entry 338058            CDS       T01008                                  Symbol ARF1 Name (RefSeq) ADP-ribosylation factor 1   KO K07937   ADP-ribosylation factor 1/2 Organism bta  Bos taurus (cow) Pathway bta04072   Phospholipase D signaling pathway bta04144   Endocytosis bta05132   Salmonella infection bta05134   Legionellosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     338058 (ARF1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     338058 (ARF1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     338058 (ARF1)    05134 Legionellosis     338058 (ARF1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     338058 (ARF1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     338058 (ARF1)    04031 GTP-binding proteins [BR:bta04031]     338058 (ARF1) Membrane trafficking [BR:bta04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     338058 (ARF1)   Arf GTPases and associated proteins    Arf GTPases     338058 (ARF1)  Endosome - Golgi transport     338058 (ARF1) Exosome [BR:bta04147]  Exosomal proteins   Proteins found in most exosomes    338058 (ARF1) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     338058 (ARF1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M cobW Motif Other DBs NCBI-GeneID:  338058 NCBI-ProteinID:  NP_788826 BGD-bta:  BT11284 Ensembl:  ENSBTAG00000007725 VGNC:  50209 UniProt:  P84080 Structure PDBPDBj LinkDB All DBs Position 7:complement(3001505..3019579) Genome browser AA seq 181 aa AA seqDB search MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggggaatatctttgcaaacctcttcaagggcctttttggcaaaaaagaaatgcgcatt ctcatggtgggcctagatgctgcgggaaagaccaccatcctgtacaaactgaagctgggt gaaattgtgaccaccattcccactattggcttcaacgtggagaccgtggagtacaagaac atcagcttcactgtgtgggacgtgggtggccaggacaagatccggcctctgtggcgccac tactttcaaaacacacaaggtctcatctttgtggttgacagcaatgacagagagcgtgtg aatgaggcccgtgaggagctcatgaggatgttggcagaagacgagctcagggacgccgtt ctgctcgtgtttgctaacaaacaggacctccctaatgccatgaacgcggccgagatcacg gacaagctgggcctgcactctctgcgccacaggaactggtacattcaggccacctgtgcc accagtggggacgggctttacgagggactggactggctgtccaatcagctccggaaccag aaatga

DBGET integrated database retrieval system