Bos taurus (cow): 404153 Help Entry 404153            CDS       T01008                                  Symbol CLDN3 Name (RefSeq) claudin-3   KO K06087   claudin Organism bta  Bos taurus (cow) Pathway bta03272   Virion - Hepatitis viruses bta04382   Cornified envelope formation bta04514   Cell adhesion molecule (CAM) interaction bta04530   Tight junction bta04670   Leukocyte transendothelial migration bta05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     404153 (CLDN3)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     404153 (CLDN3)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     404153 (CLDN3)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     404153 (CLDN3)   09158 Development and regeneration    04382 Cornified envelope formation     404153 (CLDN3)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     404153 (CLDN3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bta03037]     404153 (CLDN3)    04147 Exosome [BR:bta04147]     404153 (CLDN3) Cilium and associated proteins [BR:bta03037]  Other cilia and associated proteins   Stereociliary proteins    404153 (CLDN3) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    404153 (CLDN3)   Exosomal proteins of colorectal cancer cells    404153 (CLDN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 CdpA_N TMEM37 Motif Other DBs NCBI-GeneID:  404153 NCBI-ProteinID:  NP_991370 BGD-bta:  BT28035 Ensembl:  ENSBTAG00000040432 VGNC:  27414 UniProt:  Q765N9 LinkDB All DBs Position 25:33507968..33509182 Genome browser AA seq 219 aa AA seqDB search MSMGLEIAGTSLAVLGWLCTIVCCALPMWRVTAFIGSSIITAQITWEGLWMNCVVQSTGQ MQCKVYDSLLALPQDLQAARALIVIAILLAVFGLLVALVGAQCTNCVQDDTAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPLVPEAQKREMGAALYVGWAASALQLLGGALL CCSCPPRDNYARTKIVYSAPRSTGPVTSTGTAYDRKDYV NT seq 660 nt NT seq  +upstreamnt  +downstreamnt atgtccatgggcctggagatcgcgggcacctcgctggccgtgctgggctggctgtgcacc atcgtgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcagcatcatc acggcgcagatcacctgggagggactgtggatgaactgcgtggtgcagagcaccggccag atgcagtgcaaggtgtacgactcactgctggcgctgccgcaggacctgcaggcggcccgc gccctcatcgtcatcgccatcctactggccgtcttcgggctcctcgtggcgctcgtgggc gcccagtgcaccaactgcgtgcaggacgacacggccaaggccaagatcaccatcgtggcg ggcgtgctcttcctgctggccgccctgctgaccctcgtgccggtgtcctggtcggccaac accatcatccgggacttttacaaccccttggtgcccgaggctcagaagcgcgagatgggc gccgccctgtacgtgggctgggcggcgtccgcgctgcagctgctggggggcgcgctgctc tgctgctcctgcccgccgcgcgacaactacgcgcggaccaagatcgtctactcggcgccg cgctccaccgggcccgtcactagcaccggcacggcctacgaccgcaaggactacgtctga

DBGET integrated database retrieval system