Bos taurus (cow): 414921 Help Entry 414921            CDS       T01008                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism bta  Bos taurus (cow) Pathway bta03272   Virion - Hepatitis viruses bta04382   Cornified envelope formation bta04514   Cell adhesion molecules bta04530   Tight junction bta04670   Leukocyte transendothelial migration bta05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     414921 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     414921 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     414921 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     414921 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     414921 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     414921 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bta03037]     414921 (CLDN4)    04147 Exosome [BR:bta04147]     414921 (CLDN4)    04515 Cell adhesion molecules [BR:bta04515]     414921 (CLDN4) Cilium and associated proteins [BR:bta03037]  Other cilia and associated proteins   Stereociliary proteins    414921 (CLDN4) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    414921 (CLDN4)   Exosomal proteins of colorectal cancer cells    414921 (CLDN4) Cell adhesion molecules [BR:bta04515]  Immunoglobulin superfamily   L1 family    414921 (CLDN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 L_HMGIC_fpl TMEM37 TMEM_230_134 Clc-like DUF4131 DUF7139 Motif Other DBs NCBI-GeneID:  414921 NCBI-ProteinID:  NP_001014413 BGD-bta:  BT18027 Ensembl:  ENSBTAG00000026278 VGNC:  27416 UniProt:  Q6BBL6 LinkDB All DBs Position 25:complement(33477754..33479301) Genome browser AA seq 209 aa AA seqDB search MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALIVICIILAVFGVLLSVVGGKCTNCVDDESSKAKIMIV AGVVFLLAGLLVMVPVSWTANNVIRDFYNPLVASGQKREMGASLYVGWAAAGLLILGGAL LCFNCPPRNDKPYSAKYSAARSAPASNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggcttccatggggctgcaggtgatgggcatcgcgctggccgtgctgggctggctgggc gccatcctgagctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatc gtcacgtcgcagaccatctgggagggcctatggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcc cgtgccctcatcgtcatctgtatcatcctggccgtgtttggcgtgctgttgtcggtggtg ggcggcaagtgcaccaactgtgtggatgatgagagctccaaggccaagatcatgatcgtg gccggcgtggtgttcctgctggccggcctgctggtgatggtgcccgtgtcctggacggct aacaacgtcatccgcgacttctacaaccccctggtggcctcgggccagaagcgggagatg ggggcctcgctctacgtgggctgggccgccgctggcttgctgatccttgggggggccctg ctctgcttcaactgcccgccccgcaacgacaagccctactccgctaagtactccgccgcc cgctccgccccagccagcaactacgtctaa

DBGET integrated database retrieval system