Bos taurus (cow): 414922 Help Entry 414922            CDS       T01008                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism bta  Bos taurus (cow) Pathway bta03272   Virion - Hepatitis viruses bta04382   Cornified envelope formation bta04514   Cell adhesion molecule (CAM) interaction bta04530   Tight junction bta04670   Leukocyte transendothelial migration bta05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     414922 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     414922 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     414922 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     414922 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     414922 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     414922 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bta03037]     414922 (CLDN1)    04147 Exosome [BR:bta04147]     414922 (CLDN1) Cilium and associated proteins [BR:bta03037]  Other cilia and associated proteins   Stereociliary proteins    414922 (CLDN1) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    414922 (CLDN1)   Exosomal proteins of colorectal cancer cells    414922 (CLDN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Voltage_CLC DUF7937 HAAS_TM DUF6336 SUR7 DUF4134 TMEM174 Motif Other DBs NCBI-GeneID:  414922 NCBI-ProteinID:  NP_001001854 BGD-bta:  BT21033 Ensembl:  ENSBTAG00000013148 VGNC:  27402 UniProt:  Q6L708 LinkDB All DBs Position 1:76973824..76989404 Genome browser AA seq 211 aa AA seqDB search MANAGLQLLGFILAFLGWIGSIVSTALPQWKVYSYASDNIVTAQAIYEGLWMSCVSQSTG QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKCMKCMEDDEAQKMRMAV FGGVIFLISGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFIGWAAASLCLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcggggttgcagctgctgggcttcatcctggcgtttctgggctggatcggc tccatcgtcagcacggcgctgccccagtggaaagtttactcctatgctagtgacaacatc gtgacggcccaggccatctatgaggggctgtggatgtcctgcgtgtcgcagagcaccggg cagatccagtgcaaagtcttcgactccttgctgaatctgaacagcactttgcaagcaacc cgtgccttgatggtgattggcatcctgctgggactaatagccatctttgtggccaccgtt ggcatgaagtgtatgaagtgcatggaagacgacgaggcacagaagatgcggatggctgtc tttgggggcgtgatctttcttatttcaggtctggctattttagttgccacagcatggtat ggcaatagaattgttcaagaattctatgaccccatgaccccggtcaatgccaggtatgaa tttggtcaggctctcttcattggctgggctgctgcttctctctgccttctgggaggcgcc ctgctgtgctgctcctgtccccggaaaacaacatcttacccaacacccaggccctatccc aagccagcaccttccagtgggaaagactatgtgtga

DBGET integrated database retrieval system