Bos taurus (cow): 506322 Help Entry 506322            CDS       T01008                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism bta  Bos taurus (cow) Pathway bta01521   EGFR tyrosine kinase inhibitor resistance bta01522   Endocrine resistance bta04010   MAPK signaling pathway bta04012   ErbB signaling pathway bta04014   Ras signaling pathway bta04015   Rap1 signaling pathway bta04062   Chemokine signaling pathway bta04068   FoxO signaling pathway bta04071   Sphingolipid signaling pathway bta04072   Phospholipase D signaling pathway bta04137   Mitophagy - animal bta04140   Autophagy - animal bta04150   mTOR signaling pathway bta04151   PI3K-Akt signaling pathway bta04210   Apoptosis bta04211   Longevity regulating pathway bta04213   Longevity regulating pathway - multiple species bta04218   Cellular senescence bta04360   Axon guidance bta04370   VEGF signaling pathway bta04371   Apelin signaling pathway bta04540   Gap junction bta04550   Signaling pathways regulating pluripotency of stem cells bta04625   C-type lectin receptor signaling pathway bta04650   Natural killer cell mediated cytotoxicity bta04660   T cell receptor signaling pathway bta04662   B cell receptor signaling pathway bta04664   Fc epsilon RI signaling pathway bta04714   Thermogenesis bta04720   Long-term potentiation bta04722   Neurotrophin signaling pathway bta04725   Cholinergic synapse bta04726   Serotonergic synapse bta04730   Long-term depression bta04810   Regulation of actin cytoskeleton bta04910   Insulin signaling pathway bta04912   GnRH signaling pathway bta04915   Estrogen signaling pathway bta04916   Melanogenesis bta04917   Prolactin signaling pathway bta04919   Thyroid hormone signaling pathway bta04921   Oxytocin signaling pathway bta04926   Relaxin signaling pathway bta04929   GnRH secretion bta04933   AGE-RAGE signaling pathway in diabetic complications bta04935   Growth hormone synthesis, secretion and action bta05010   Alzheimer disease bta05022   Pathways of neurodegeneration - multiple diseases bta05034   Alcoholism bta05160   Hepatitis C bta05161   Hepatitis B bta05163   Human cytomegalovirus infection bta05165   Human papillomavirus infection bta05166   Human T-cell leukemia virus 1 infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05170   Human immunodeficiency virus 1 infection bta05200   Pathways in cancer bta05203   Viral carcinogenesis bta05205   Proteoglycans in cancer bta05206   MicroRNAs in cancer bta05207   Chemical carcinogenesis - receptor activation bta05208   Chemical carcinogenesis - reactive oxygen species bta05210   Colorectal cancer bta05211   Renal cell carcinoma bta05213   Endometrial cancer bta05214   Glioma bta05215   Prostate cancer bta05216   Thyroid cancer bta05218   Melanoma bta05219   Bladder cancer bta05220   Chronic myeloid leukemia bta05221   Acute myeloid leukemia bta05223   Non-small cell lung cancer bta05224   Breast cancer bta05225   Hepatocellular carcinoma bta05226   Gastric cancer bta05230   Central carbon metabolism in cancer bta05231   Choline metabolism in cancer bta05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     506322 (NRAS)    04015 Rap1 signaling pathway     506322 (NRAS)    04068 FoxO signaling pathway     506322 (NRAS)    04072 Phospholipase D signaling pathway     506322 (NRAS)    04071 Sphingolipid signaling pathway     506322 (NRAS)    04151 PI3K-Akt signaling pathway     506322 (NRAS)    04150 mTOR signaling pathway     506322 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     506322 (NRAS)    04137 Mitophagy - animal     506322 (NRAS)   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     506322 (NRAS)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     506322 (NRAS)    04660 T cell receptor signaling pathway     506322 (NRAS)    04662 B cell receptor signaling pathway     506322 (NRAS)    04664 Fc epsilon RI signaling pathway     506322 (NRAS)    04062 Chemokine signaling pathway     506322 (NRAS)   09152 Endocrine system    04929 GnRH secretion     506322 (NRAS)    04915 Estrogen signaling pathway     506322 (NRAS)    04917 Prolactin signaling pathway     506322 (NRAS)    04921 Oxytocin signaling pathway     506322 (NRAS)    04926 Relaxin signaling pathway     506322 (NRAS)    04935 Growth hormone synthesis, secretion and action     506322 (NRAS)    04919 Thyroid hormone signaling pathway     506322 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     506322 (NRAS)    04726 Serotonergic synapse     506322 (NRAS)    04720 Long-term potentiation     506322 (NRAS)    04730 Long-term depression     506322 (NRAS)    04722 Neurotrophin signaling pathway     506322 (NRAS)   09158 Development and regeneration    04360 Axon guidance     506322 (NRAS)   09149 Aging    04211 Longevity regulating pathway     506322 (NRAS)    04213 Longevity regulating pathway - multiple species     506322 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     506322 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     506322 (NRAS)    05206 MicroRNAs in cancer     506322 (NRAS)    05205 Proteoglycans in cancer     506322 (NRAS)    05207 Chemical carcinogenesis - receptor activation     506322 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     506322 (NRAS)    05203 Viral carcinogenesis     506322 (NRAS)    05230 Central carbon metabolism in cancer     506322 (NRAS)    05231 Choline metabolism in cancer     506322 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     506322 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     506322 (NRAS)    05225 Hepatocellular carcinoma     506322 (NRAS)    05226 Gastric cancer     506322 (NRAS)    05214 Glioma     506322 (NRAS)    05216 Thyroid cancer     506322 (NRAS)    05221 Acute myeloid leukemia     506322 (NRAS)    05220 Chronic myeloid leukemia     506322 (NRAS)    05218 Melanoma     506322 (NRAS)    05211 Renal cell carcinoma     506322 (NRAS)    05219 Bladder cancer     506322 (NRAS)    05215 Prostate cancer     506322 (NRAS)    05213 Endometrial cancer     506322 (NRAS)    05224 Breast cancer     506322 (NRAS)    05223 Non-small cell lung cancer     506322 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     506322 (NRAS)    05170 Human immunodeficiency virus 1 infection     506322 (NRAS)    05161 Hepatitis B     506322 (NRAS)    05160 Hepatitis C     506322 (NRAS)    05163 Human cytomegalovirus infection     506322 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     506322 (NRAS)    05165 Human papillomavirus infection     506322 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     506322 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     506322 (NRAS)   09165 Substance dependence    05034 Alcoholism     506322 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     506322 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     506322 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     506322 (NRAS)    01522 Endocrine resistance     506322 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     506322 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     506322 (NRAS)    04031 GTP-binding proteins [BR:bta04031]     506322 (NRAS) Membrane trafficking [BR:bta04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     506322 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     506322 (NRAS) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    506322 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    506322 (NRAS)   Exosomal proteins of breast cancer cells    506322 (NRAS)   Exosomal proteins of colorectal cancer cells    506322 (NRAS) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     506322 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  506322 NCBI-ProteinID:  NP_001091458 BGD-bta:  BT12943 Ensembl:  ENSBTAG00000046797 VGNC:  32253 UniProt:  A5D7R9 LinkDB All DBs Position 3:28614965..28624865 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcctac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtgtttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagata aagcgtgtaaaggactcggatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaaaagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaagctcaacagcagtgatgatggcactcaaggc tgtatggggttgccgtgtgtggtgatgtaa

DBGET integrated database retrieval system