Bos taurus (cow): 507390 Help Entry 507390            CDS       T01008                                  Symbol BCL2L11 Name (RefSeq) bcl-2-like protein 11   KO K16341   Bcl-2-like protein 11 Organism bta  Bos taurus (cow) Pathway bta01521   EGFR tyrosine kinase inhibitor resistance bta04068   FoxO signaling pathway bta04151   PI3K-Akt signaling pathway bta04210   Apoptosis bta04215   Apoptosis - multiple species bta04932   Non-alcoholic fatty liver disease bta05169   Epstein-Barr virus infection bta05200   Pathways in cancer bta05206   MicroRNAs in cancer bta05210   Colorectal cancer Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     507390 (BCL2L11)    04151 PI3K-Akt signaling pathway     507390 (BCL2L11)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     507390 (BCL2L11)    04215 Apoptosis - multiple species     507390 (BCL2L11)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     507390 (BCL2L11)    05206 MicroRNAs in cancer     507390 (BCL2L11)   09162 Cancer: specific types    05210 Colorectal cancer     507390 (BCL2L11)   09172 Infectious disease: viral    05169 Epstein-Barr virus infection     507390 (BCL2L11)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     507390 (BCL2L11)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     507390 (BCL2L11) SSDB OrthologParalogGFIT Motif Pfam:  Bclx_interact Bim_N BMF G_path_suppress PMAIP1 Motif Other DBs NCBI-GeneID:  507390 NCBI-ProteinID:  NP_001068778 BGD-bta:  BT24239 Ensembl:  ENSBTAG00000024105 VGNC:  50256 UniProt:  Q2YDF0 F6S0I5 LinkDB All DBs Position 11 Genome browser AA seq 139 aa AA seqDB search MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPP CQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHP QMVLLRVLRYIVRLVWRMQ NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggcaaagcaaccttccgatgtaagttctgagtgtgacagagaaggtggacaattgcag cctgccgagaggcctcctcagctcagacctggggcccccacctctttacagacagagcgg caagacaggagcccggcacccatgagttgtgacaaatccacacagaccccaagccctcct tgccaggccttcaaccattatctcagtgcaatggcttccatgaggcagtctcaggctgta cctgcagatacacgcccagagatatggattgcccaagagctacggcgtatcggagacgag tttaatgcatattacccaagaagggtcttcgtgcgtcaccaggcagttgagggccacccg caaatggtcctcttgcgcgtcttgcgctacatcgtgcgtctggtgtggaggatgcagtga

DBGET integrated database retrieval system