Bos taurus (cow): 508373 Help Entry 508373            CDS       T01008                                  Symbol RAB2A Name (RefSeq) ras-related protein Rab-2A   KO K07877   Ras-related protein Rab-2A Organism bta  Bos taurus (cow) Pathway bta04152   AMPK signaling pathway Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     508373 (RAB2A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     508373 (RAB2A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     508373 (RAB2A)    04031 GTP-binding proteins [BR:bta04031]     508373 (RAB2A) Membrane trafficking [BR:bta04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab GTPases     508373 (RAB2A) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    508373 (RAB2A)   Exosomal proteins of other body fluids (saliva and urine)    508373 (RAB2A)   Exosomal proteins of colorectal cancer cells    508373 (RAB2A) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Rab Family    Rab2/4/14 [OT]     508373 (RAB2A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA AAA_22 DAP3 Motif Other DBs NCBI-GeneID:  508373 NCBI-ProteinID:  NP_001068822 BGD-bta:  BT30419 Ensembl:  ENSBTAG00000000948 VGNC:  33637 UniProt:  Q148J4 LinkDB All DBs Position 14:26180795..26253378 Genome browser AA seq 189 aa AA seqDB search MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEANGIKIGPQHAATNATHAGSQG GQQAGGGCC NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcgtacgcctatctcttcaagtacatcatcatcggcgacacaggtgttggtaaatca tgcttattgctacagtttacagacaagaggtttcagccagtgcatgaccttactattggt gttgagtttggtgctcgaatgataactattgatggaaaacagataaaacttcagatatgg gatacggcagggcaagagtccttccgttccatcacacggtcatattacagaggagcagca ggggctttgctagtgtatgatattacaaggagagacacattcaaccacttgacaacctgg ttagaagatgcccgccagcattccaattccaacatggtcattatgcttattggaaataaa agtgatttagaatctagaagagaagtaaaaaaagaagaaggtgaagcttttgcacgagaa cacggacttatcttcatggaaacttctgctaagactgcttctaatgtagaagaggcaaac ggcattaaaattggccctcagcatgctgctaccaatgccacacacgcaggcagccaggga ggacagcaggccgggggcggctgctgttga

DBGET integrated database retrieval system