Bos taurus (cow): 508874 Help Entry 508874            CDS       T01008                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism bta  Bos taurus (cow) Pathway bta04015   Rap1 signaling pathway bta04810   Regulation of actin cytoskeleton bta05014   Amyotrophic lateral sclerosis bta05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     508874 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     508874 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     508874 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     508874 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     508874 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bta04812]     508874 (PFN4)    04147 Exosome [BR:bta04147]     508874 (PFN4) Membrane trafficking [BR:bta04131]  Others   Actin-binding proteins    Others     508874 (PFN4) Cytoskeleton proteins [BR:bta04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      508874 (PFN4) Exosome [BR:bta04147]  Exosomal proteins   Proteins found in most exosomes    508874 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  508874 NCBI-ProteinID:  NP_001068845 BGD-bta:  BT22465 Ensembl:  ENSBTAG00000003404 VGNC:  32778 UniProt:  Q2NKT1 LinkDB All DBs Position 11:74974219..74978082 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLCVASPGFSVMPSDVRTLVNGFAKNPLKTR REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHLYLLVATYSEGMYPSVCVEATEKL GDYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagatacactcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcggagcctatgtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaacacttgtaaatgggtttgccaagaaccctttgaaaaccaga agagaaggactgtatttcaaggagaaggactacaaatgtgtccgggcagatgactattct ctttatgccaagaatgaaaacactggtgtgattgttgtgaagacccatctgtatcttctg gtggcaacttactctgaaggcatgtatcctagtgtctgtgtggaagccacagagaagttg ggagactatctaagaagaaaagggaattaa

DBGET integrated database retrieval system