Bos taurus (cow): 512703 Help Entry 512703            CDS       T01008                                  Symbol CLDN17 Name (RefSeq) claudin-17   KO K06087   claudin Organism bta  Bos taurus (cow) Pathway bta03272   Virion - Hepatitis viruses bta04382   Cornified envelope formation bta04514   Cell adhesion molecules bta04530   Tight junction bta04670   Leukocyte transendothelial migration bta05160   Hepatitis C Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     512703 (CLDN17)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     512703 (CLDN17)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     512703 (CLDN17)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     512703 (CLDN17)   09158 Development and regeneration    04382 Cornified envelope formation     512703 (CLDN17)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     512703 (CLDN17)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bta03037]     512703 (CLDN17)    04147 Exosome [BR:bta04147]     512703 (CLDN17)    04515 Cell adhesion molecules [BR:bta04515]     512703 (CLDN17) Cilium and associated proteins [BR:bta03037]  Other cilia and associated proteins   Stereociliary proteins    512703 (CLDN17) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    512703 (CLDN17)   Exosomal proteins of colorectal cancer cells    512703 (CLDN17) Cell adhesion molecules [BR:bta04515]  Immunoglobulin superfamily   L1 family    512703 (CLDN17) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Claudin_3 DUF7139 DNER_C DUF4064 Clc-like DUF308 Motif Other DBs NCBI-GeneID:  512703 NCBI-ProteinID:  XP_010799221 BGD-bta:  BT25746 Ensembl:  ENSBTAG00000039255 VGNC:  27407 UniProt:  A0AAA9SWH8 LinkDB All DBs Position 1:5829566..5832083 Genome browser AA seq 225 aa AA seqDB search MAFYPLQIAGLVLGFFGMIGTLTTTLLPQWRVSAFIGSNIIVFERVWEGLWMNCVRQAKD KLQCKVYDSLLALPPALEAARALMCVAVALSVIALLVGICGMKKIQCTGSNRRAKAYLVG ISGVLFILTGIFVLIPVCWMANNIIRDFYNPAVHVGQKRELGASLFVGWATTAVLIIGGV LLCGFCCCNRNRPRHRYLAPGHRVPHARNPPRPVAVLSRTSTSYV NT seq 678 nt NT seq  +upstreamnt  +downstreamnt atggcattttatccactgcaaatcgctggactggttcttgggttcttcggcatgatcggg acccttaccacaactcttctgcctcagtggagagtatcggcttttattggcagcaacatt attgtcttcgaaagggtctgggaaggcctctggatgaactgcgtccgacaagccaaggat aagttgcagtgcaaggtctatgattctttgctggccctccctcctgccctagaggcagcc cgggccctcatgtgtgtggctgtagccttatctgtgattgctctgcttgttggtatctgt ggcatgaagaagattcagtgcacaggctctaaccggagggcaaaagcatacctcgtggga atttccggagtcctctttatcctgaccggcatcttcgttctgattccggtgtgctggatg gccaataacatcatcagggatttctacaacccagcggtccacgtgggtcagaaacgagaa ctgggagcttcactcttcgtcggctgggccactaccgcggtcctcatcatcggaggggtt ctgctctgtgggttctgctgttgcaaccgaaacaggccaaggcacagatatttagcccct gggcatcgtgtgccacatgcacgtaatccaccacggccagtggcagtgctcagtaggact tccaccagttacgtctaa

DBGET integrated database retrieval system