Bos taurus (cow): 513666 Help Entry 513666            CDS       T01008                                  Symbol H2AC20 Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism bta  Bos taurus (cow) Pathway bta03082   ATP-dependent chromatin remodeling bta04217   Necroptosis bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     513666 (H2AC20)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     513666 (H2AC20)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     513666 (H2AC20)  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     513666 (H2AC20)   09165 Substance dependence    05034 Alcoholism     513666 (H2AC20)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     513666 (H2AC20)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     513666 (H2AC20) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     513666 (H2AC20) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    513666 (H2AC20) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  513666 NCBI-ProteinID:  NP_001075189 VGNC:  83605 UniProt:  A1A4R1 LinkDB All DBs Position 3:complement(20724727..20725185) Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggaaagcagggaggcaaggcccgcgcaaaggccaagtcgcgttcgtcc cgcgcaggcttgcagttcccggtagggcgagtgcaccgcctgctgcgcaaaggcaactac gctgagcgggtgggggccggcgcgcccgtctacatggcggcggttctggagtatctgaca gccgagatcctggagctggccggcaacgcggcgcgagacaacaaaaagacgcgcatcatc cctcgtcacctgcagttggccatccgcaacgacgaagagctgaacaagctgttgggcaag gtcaccatcgcccagggcggcgttttgcccaatatccaggccgttctgttaccaaagaaa accgaaagccataaagccaaaagcaaataa

DBGET integrated database retrieval system