Bos taurus (cow): 513895 Help Entry 513895            CDS       T01008                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism bta  Bos taurus (cow) Pathway bta04015   Rap1 signaling pathway bta04810   Regulation of actin cytoskeleton bta05014   Amyotrophic lateral sclerosis bta05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     513895 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     513895 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     513895 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     513895 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     513895 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bta04812]     513895 (PFN1)    04147 Exosome [BR:bta04147]     513895 (PFN1) Membrane trafficking [BR:bta04131]  Others   Actin-binding proteins    Others     513895 (PFN1) Cytoskeleton proteins [BR:bta04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      513895 (PFN1) Exosome [BR:bta04147]  Exosomal proteins   Proteins found in most exosomes    513895 (PFN1) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  513895 NCBI-ProteinID:  NP_001015592 BGD-bta:  BT11872 Ensembl:  ENSBTAG00000004915 UniProt:  P02584 Structure PDBPDBj LinkDB All DBs Position 19 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgca gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccggcaagaccttc gtcaacatcacgcctgctgaggtcggtatcctggttggcaaagaccggtcaagttttttc gtgaacgggctaacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggagaatttaccatggatcttcgtaccaagagcaccggtggagccccaaccttcaat atcacggtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcggtatgatcaacaagaaatgttatgaaatggcttctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system