Bos taurus (cow): 518601 Help Entry 518601            CDS       T01008                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism bta  Bos taurus (cow) Pathway bta04144   Endocytosis Brite KEGG Orthology (KO) [BR:bta00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     518601 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     518601 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     518601 (ARF4)    04031 GTP-binding proteins [BR:bta04031]     518601 (ARF4) Membrane trafficking [BR:bta04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     518601 (ARF4) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    518601 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    518601 (ARF4)   Exosomal proteins of colorectal cancer cells    518601 (ARF4) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     518601 (ARF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf SRPRB Roc Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K GTP_EFTU Motif Other DBs NCBI-GeneID:  518601 NCBI-ProteinID:  NP_001029702 BGD-bta:  BT12200 Ensembl:  ENSBTAG00000016069 VGNC:  26059 UniProt:  Q3SZF2 LinkDB All DBs Position 22:43606541..43625327 Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAEELQKMLQEDELRDAV LLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatctcctccctcttctcccgcctcttcggcaagaagcagatgcgcatt ttgatggttggattggacgctgctggcaagacgaccattctgtataaactgaagttaggg gagatagtcaccaccattcctaccattggttttaatgtggaaacagtagaatataagaac atttgtttcacagtatgggatgttggtggtcaagataaaattaggcctctctggaggcat tactttcaaaatacccagggtcttatttttgtggtagatagcaatgatcgtgaaagaatt caggaaggagcagaagagctgcagaaaatgcttcaggaagatgagttgcgagatgcagtg ttgctgctttttgcaaacaaacaggacttgccgaatgctatggccattagtgaaatgaca gataaattaggtcttcagtcccttcgtaacagaacatggtatgttcaagccacttgtgct acacaaggaaccggtctgtatgagggacttgactggctgtcaaatgagctttcaaaacgt taa

DBGET integrated database retrieval system