Bos taurus (cow): 519269 Help Entry 519269            CDS       T01008                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism bta  Bos taurus (cow) Pathway bta04010   MAPK signaling pathway bta04014   Ras signaling pathway bta04024   cAMP signaling pathway bta04072   Phospholipase D signaling pathway bta04137   Mitophagy - animal bta04140   Autophagy - animal bta04218   Cellular senescence bta04371   Apelin signaling pathway bta04625   C-type lectin receptor signaling pathway bta04810   Regulation of actin cytoskeleton bta05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     519269 (RRAS2)    04014 Ras signaling pathway     519269 (RRAS2)    04371 Apelin signaling pathway     519269 (RRAS2)    04072 Phospholipase D signaling pathway     519269 (RRAS2)    04024 cAMP signaling pathway     519269 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     519269 (RRAS2)    04137 Mitophagy - animal     519269 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     519269 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     519269 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     519269 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     519269 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     519269 (RRAS2)    04031 GTP-binding proteins [BR:bta04031]     519269 (RRAS2) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    519269 (RRAS2)   Exosomal proteins of bladder cancer cells    519269 (RRAS2) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     519269 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  519269 NCBI-ProteinID:  NP_001092480 BGD-bta:  BT25664 Ensembl:  ENSBTAG00000011905 VGNC:  49569 UniProt:  A5PKL2 LinkDB All DBs Position 15:38367194..38444339 Genome browser AA seq 204 aa AA seqDB search MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDR AARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEF PMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQE QECPPSPEPTRKEKDKKGCHCVIF NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggccgcggccggctggcgggacggctccggccaggagaagtaccggctggtggtggtc ggtggaggcggcgtgggcaaatcggcgctcaccatccagttcatccagtcttattttgta acggattatgatccaaccatcgaggattcctacacaaagcagtgtgtgatagatgaccgg gcagcccggctagacattctggatacagcgggacaagaggaatttggagctatgagagaa cagtatatgagaactggcgagggtttccttttggtcttttcagtcacagacagaggcagt tttgaagaaatctataagtttcaaagacagattctcagagtaaaggatcgtgatgagttt ccaatgattttaattggtaataaagcagatctggatcatcagagacaggtaacacaggaa gaaggacagcagttagcacggcaacttaaggtaacatacatggaggcgtcagcaaagatt agaatgaatgtagatcaagctttccatgaacttgtccgggttataaggaaatttcaagag caggaatgtcctccttcaccagaaccaacacggaaagaaaaagacaagaaaggctgccat tgtgtcattttctaa

DBGET integrated database retrieval system