Bos taurus (cow): 520404 Help Entry 520404            CDS       T01008                                  Symbol CALML5 Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism bta  Bos taurus (cow) Pathway bta04014   Ras signaling pathway bta04015   Rap1 signaling pathway bta04020   Calcium signaling pathway bta04022   cGMP-PKG signaling pathway bta04024   cAMP signaling pathway bta04070   Phosphatidylinositol signaling system bta04114   Oocyte meiosis bta04218   Cellular senescence bta04261   Adrenergic signaling in cardiomyocytes bta04270   Vascular smooth muscle contraction bta04371   Apelin signaling pathway bta04625   C-type lectin receptor signaling pathway bta04713   Circadian entrainment bta04720   Long-term potentiation bta04722   Neurotrophin signaling pathway bta04728   Dopaminergic synapse bta04740   Olfactory transduction bta04744   Phototransduction bta04750   Inflammatory mediator regulation of TRP channels bta04910   Insulin signaling pathway bta04912   GnRH signaling pathway bta04915   Estrogen signaling pathway bta04916   Melanogenesis bta04921   Oxytocin signaling pathway bta04922   Glucagon signaling pathway bta04924   Renin secretion bta04925   Aldosterone synthesis and secretion bta04970   Salivary secretion bta04971   Gastric acid secretion bta05010   Alzheimer disease bta05012   Parkinson disease bta05022   Pathways of neurodegeneration - multiple diseases bta05031   Amphetamine addiction bta05034   Alcoholism bta05133   Pertussis bta05152   Tuberculosis bta05163   Human cytomegalovirus infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05170   Human immunodeficiency virus 1 infection bta05200   Pathways in cancer bta05214   Glioma bta05417   Lipid and atherosclerosis bta05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     520404 (CALML5)    04015 Rap1 signaling pathway     520404 (CALML5)    04371 Apelin signaling pathway     520404 (CALML5)    04020 Calcium signaling pathway     520404 (CALML5)    04070 Phosphatidylinositol signaling system     520404 (CALML5)    04024 cAMP signaling pathway     520404 (CALML5)    04022 cGMP-PKG signaling pathway     520404 (CALML5)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     520404 (CALML5)    04218 Cellular senescence     520404 (CALML5)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     520404 (CALML5)   09152 Endocrine system    04910 Insulin signaling pathway     520404 (CALML5)    04922 Glucagon signaling pathway     520404 (CALML5)    04912 GnRH signaling pathway     520404 (CALML5)    04915 Estrogen signaling pathway     520404 (CALML5)    04921 Oxytocin signaling pathway     520404 (CALML5)    04916 Melanogenesis     520404 (CALML5)    04924 Renin secretion     520404 (CALML5)    04925 Aldosterone synthesis and secretion     520404 (CALML5)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     520404 (CALML5)    04270 Vascular smooth muscle contraction     520404 (CALML5)   09154 Digestive system    04970 Salivary secretion     520404 (CALML5)    04971 Gastric acid secretion     520404 (CALML5)   09156 Nervous system    04728 Dopaminergic synapse     520404 (CALML5)    04720 Long-term potentiation     520404 (CALML5)    04722 Neurotrophin signaling pathway     520404 (CALML5)   09157 Sensory system    04744 Phototransduction     520404 (CALML5)    04740 Olfactory transduction     520404 (CALML5)    04750 Inflammatory mediator regulation of TRP channels     520404 (CALML5)   09159 Environmental adaptation    04713 Circadian entrainment     520404 (CALML5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     520404 (CALML5)   09162 Cancer: specific types    05214 Glioma     520404 (CALML5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     520404 (CALML5)    05163 Human cytomegalovirus infection     520404 (CALML5)    05167 Kaposi sarcoma-associated herpesvirus infection     520404 (CALML5)   09171 Infectious disease: bacterial    05133 Pertussis     520404 (CALML5)    05152 Tuberculosis     520404 (CALML5)   09164 Neurodegenerative disease    05010 Alzheimer disease     520404 (CALML5)    05012 Parkinson disease     520404 (CALML5)    05022 Pathways of neurodegeneration - multiple diseases     520404 (CALML5)   09165 Substance dependence    05031 Amphetamine addiction     520404 (CALML5)    05034 Alcoholism     520404 (CALML5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     520404 (CALML5)    05418 Fluid shear stress and atherosclerosis     520404 (CALML5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bta01009]     520404 (CALML5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     520404 (CALML5)    03036 Chromosome and associated proteins [BR:bta03036]     520404 (CALML5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     520404 (CALML5) Protein phosphatases and associated proteins [BR:bta01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      520404 (CALML5) Membrane trafficking [BR:bta04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     520404 (CALML5) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      520404 (CALML5) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    520404 (CALML5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_FSTL1 EF-hand_9 EH SPARC_Ca_bdg DUF5580_M EF-hand_STIM1 SAPC2_N EF-hand_EFHB_C EF_EFCAB10_C EF-hand_11 FCaBP_EF-hand UPF0154 EF-hand_14 SurA_N_3 TerB Phage_TAC_12 Dockerin_1 SPEF2_C NNH6 SurA_N_2 ExbD DUF6471 Motif Other DBs NCBI-GeneID:  520404 NCBI-ProteinID:  NP_001091518 BGD-bta:  BT10430 Ensembl:  ENSBTAG00000013854 VGNC:  56179 UniProt:  A4IFQ6 LinkDB All DBs Position 13:43143556..43144392 Genome browser AA seq 148 aa AA seqDB search MAEKLSEEQVAEFKEAFDRFDKNKDGTISVQELGTVMQEVGLKLSEAELKKLISQLDTDK NGSISFQEFLEAMAAGLQTSDTEGLREIFRAFDQDDDGYISVDELRQATSQLGEKVSQDE LDAMIREADVDQDGRVNYEEFVRILTQN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaagctgtccgaagagcaggtggcggagttcaaggaggccttcgacaggttc gacaagaacaaggatggcaccatcagtgtgcaggagctgggcaccgtgatgcaggaggtg ggcctgaagctgtcagaggctgagctgaagaagctcatctcccagctggacacggacaag aacggcagcatcagcttccaggagttcctggaggccatggccgcagggcttcagacctca gacacggagggcctgagggaaatcttccgtgccttcgaccaggacgacgatggctacatc agcgtggacgagctcaggcaggccacgtcccagctgggggagaaggtgtctcaggacgag ctggacgccatgatccgggaggcggacgtggaccaagacggccgggtgaactatgaggaa ttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system