Bos taurus (cow): 521379 Help Entry 521379            CDS       T01008                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism bta  Bos taurus (cow) Pathway bta04015   Rap1 signaling pathway bta04810   Regulation of actin cytoskeleton bta05014   Amyotrophic lateral sclerosis bta05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     521379 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     521379 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     521379 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     521379 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     521379 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bta04812]     521379 (PFN3)    04147 Exosome [BR:bta04147]     521379 (PFN3) Membrane trafficking [BR:bta04131]  Others   Actin-binding proteins    Others     521379 (PFN3) Cytoskeleton proteins [BR:bta04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      521379 (PFN3) Exosome [BR:bta04147]  Exosomal proteins   Proteins found in most exosomes    521379 (PFN3) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  521379 NCBI-ProteinID:  NP_001071413 Ensembl:  ENSBTAG00000020353 VGNC:  32777 UniProt:  Q32PB1 LinkDB All DBs Position 7 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRSTFL QAGLCVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTMHELIHGLRSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggttacatcagtgcagtgcttcgggaccagcgcatcgacgacgtg gccattgtgggccactcggacaatcgctgcgtgtgggcctcgaggcctgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcaccgggccagaccggagcaccttcctg caggccgggctgtgcgtggcgggccgccgttgctgcgtcatccgagaccacctgctggcg gagggtgacggagtgctggatgcacgcaccaagggtctggacgggcgcgccatctgcgtg ggccacacgcctcgggcgcttctcgtgctcatgggccggcggggtgtgcatgggggcatt ctcaacaagacgatgcacgagctgatccatgggctgcgctcacagggcacctag

DBGET integrated database retrieval system