Bos taurus (cow): 525415 Help Entry 525415            CDS       T01008                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism bta  Bos taurus (cow) Pathway bta04060   Cytokine-cytokine receptor interaction bta04061   Viral protein interaction with cytokine and cytokine receptor bta04062   Chemokine signaling pathway bta04620   Toll-like receptor signaling pathway bta05142   Chagas disease bta05163   Human cytomegalovirus infection bta05323   Rheumatoid arthritis bta05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     525415    04061 Viral protein interaction with cytokine and cytokine receptor     525415  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     525415    04062 Chemokine signaling pathway     525415  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     525415   09174 Infectious disease: parasitic    05142 Chagas disease     525415   09163 Immune disease    05323 Rheumatoid arthritis     525415   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     525415  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bta04052]     525415    00536 Glycosaminoglycan binding proteins [BR:bta00536]     525415 Cytokines and neuropeptides [BR:bta04052]  Cytokines   Chemokines    525415 Glycosaminoglycan binding proteins [BR:bta00536]  Heparan sulfate / Heparin   Chemokines    525415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 WAP Motif Other DBs NCBI-GeneID:  525415 NCBI-ProteinID:  XP_003587428 BGD-bta:  BT24178 LinkDB All DBs Position 19:14243680..14279682 Genome browser AA seq 124 aa AA seqDB search MKLGGLFLLASLLTLNTRLQAIGTCVNECREDRDCGAERECLQVGCQHVCLPLATAVSTN TPTDCCFSFVSRQIPRKLVDDYYETSSQCSKPGIIFKTKRGRQVCADPSEDWVQEYIIDL ELNP NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgaagttgggtggtctcttcctcctggccagtctcctcaccctcaacacaaggctccag gcaattggcacctgtgtgaatgagtgcagagaagacagggactgcggggcagaaagagaa tgcctccaagtgggctgccagcacgtctgcctgcctctagctacagcagttagtaccaac accccgaccgactgctgcttctccttcgtctcccggcagatcccacgcaaactcgtggac gactattatgagaccagcagccagtgctccaagcccggcatcatcttcaagaccaaaaga ggccggcaggtctgtgccgaccccagtgaggactgggtccaggaatacatcatcgacctg gagctgaatccctga

DBGET integrated database retrieval system