Bos taurus (cow): 528204 Help Entry 528204            CDS       T01008                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism bta  Bos taurus (cow) Pathway bta04072   Phospholipase D signaling pathway bta04140   Autophagy - animal bta04150   mTOR signaling pathway bta04151   PI3K-Akt signaling pathway bta04152   AMPK signaling pathway bta04211   Longevity regulating pathway bta04218   Cellular senescence bta04714   Thermogenesis bta04910   Insulin signaling pathway bta04919   Thyroid hormone signaling pathway bta05163   Human cytomegalovirus infection bta05165   Human papillomavirus infection bta05168   Herpes simplex virus 1 infection bta05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     528204 (RHEB)    04151 PI3K-Akt signaling pathway     528204 (RHEB)    04152 AMPK signaling pathway     528204 (RHEB)    04150 mTOR signaling pathway     528204 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     528204 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     528204 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     528204 (RHEB)    04919 Thyroid hormone signaling pathway     528204 (RHEB)   09149 Aging    04211 Longevity regulating pathway     528204 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     528204 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     528204 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     528204 (RHEB)    05163 Human cytomegalovirus infection     528204 (RHEB)    05165 Human papillomavirus infection     528204 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bta04031]     528204 (RHEB) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Ras Family    Rheb     528204 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase RhoGAP_pG2 SRPRB AAA_14 DUF1842 Motif Other DBs NCBI-GeneID:  528204 NCBI-ProteinID:  NP_001026934 Ensembl:  ENSBTAG00000031861 VGNC:  33939 UniProt:  Q56JV3 LinkDB All DBs Position 4:complement(114003982..114056785) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIKNTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcgttgacgattcagtttgttgaaggccaatttgttgactcctacgatccaaccataaaa aatactttcacaaaattgatcacagtaaatggacaggagtatcatcttcaacttgtggac acagctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggc tatattcttgtgtattctgttacatcaatcaaaagctttgaagtgatcaaagttatccat ggtaaattgttggatatggtggggaaagtacagatacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaagcgttagcagagtct tggaacgcagcgtttttggaatcatctgctaaagaaaatcagactgctgttgatgttttt agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc tgctcggtgatgtga

DBGET integrated database retrieval system