Bos taurus (cow): 531990 Help Entry 531990            CDS       T01008                                  Symbol HIST2H3D Name (RefSeq) histone H3   KO K11253   histone H3 Organism bta  Bos taurus (cow) Pathway bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05202   Transcriptional misregulation in cancer bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     531990 (HIST2H3D)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     531990 (HIST2H3D)   09163 Immune disease    05322 Systemic lupus erythematosus     531990 (HIST2H3D)   09165 Substance dependence    05034 Alcoholism     531990 (HIST2H3D)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     531990 (HIST2H3D)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     531990 (HIST2H3D) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     531990 (HIST2H3D) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    531990 (HIST2H3D) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  531990 NCBI-ProteinID:  XP_002685546 Ensembl:  ENSBTAG00000024003 UniProt:  E1BGN3 LinkDB All DBs Position 2:88751566..88752015 Genome browser AA seq 136 aa AA seqDB search MTRTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgacgcgtacgaagcagaccgcccggaagtcgactggtggcaaggccccgcggaagcag ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtcaagaagccgcat cgttataggccgggcaccgtggccctgcgggagattcggcgctaccagaagtcgaccgag ctgctgatccgcaagctgccgttccagcggctggtacgcgagatcgcgcaggactttaag accgatctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgtttgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatt atgcccaaagacatccagctggctcgtcgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system