Bos taurus (cow): 533874 Help Entry 533874            CDS       T01008                                  Symbol PSMB3 Name (RefSeq) proteasome subunit beta type-3   KO K02735   20S proteasome subunit beta 3 [EC:3.4.25.1] Organism bta  Bos taurus (cow) Pathway bta03050   Proteasome bta05010   Alzheimer disease bta05012   Parkinson disease bta05014   Amyotrophic lateral sclerosis bta05016   Huntington disease bta05017   Spinocerebellar ataxia bta05020   Prion disease bta05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     533874 (PSMB3)  09160 Human Diseases   09164 Neurodegenerative disease    05010 Alzheimer disease     533874 (PSMB3)    05012 Parkinson disease     533874 (PSMB3)    05014 Amyotrophic lateral sclerosis     533874 (PSMB3)    05016 Huntington disease     533874 (PSMB3)    05017 Spinocerebellar ataxia     533874 (PSMB3)    05020 Prion disease     533874 (PSMB3)    05022 Pathways of neurodegeneration - multiple diseases     533874 (PSMB3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:bta01002]     533874 (PSMB3)   09182 Protein families: genetic information processing    03051 Proteasome [BR:bta03051]     533874 (PSMB3) Enzymes [BR:bta01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.25  Threonine endopeptidases     3.4.25.1  proteasome endopeptidase complex      533874 (PSMB3) Peptidases and inhibitors [BR:bta01002]  Threonine peptidases   Family T1: proteasome family    533874 (PSMB3) Proteasome [BR:bta03051]  Eukaryotic proteasome   Core particles (20S proteasome)    beta type subunits     533874 (PSMB3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Proteasome Beta-prop_At4g14310 Motif Other DBs NCBI-GeneID:  533874 NCBI-ProteinID:  NP_001029768 BGD-bta:  BT25996 Ensembl:  ENSBTAG00000003830 VGNC:  33447 UniProt:  P33672 B0JYN8 Structure PDBPDBj LinkDB All DBs Position 19:39344060..39353531 Genome browser AA seq 205 aa AA seqDB search MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF ICSLDLIGCPMVTDDFVVSGTCTEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV SGMGVIVHIIEKDKITTRTLKARMD NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtctattatgtcctataacggaggggccgtcatggccatgaaggggaagaactgtgtg gccatcgctgctgacaggcgcttcgggatccaggcccagatggtgaccacggacttccag aagatctttcccatgggcgaccgactgtacatcggcctggcgggtcttgccaccgacgtc cagacagttgcccagcgcctcaagttccggctgaacctgtatgagctgaaggaaggccgg cagatcaaaccttacaccctcatgagcatggtagccaaccttttgtacgagaaacggttt gggccctactacacggagccggtcattgccggattggacccgaagacctttaagcctttc atttgctctctagaccttattggctgccccatggtgaccgatgactttgtagtcagtggt acctgcactgaacaaatgtacgggatgtgcgagtccctctgggagcccaacatggatcca gaacacctgtttgaaaccatctcacaagccatgctgaatgctgtggacagggatgcggtg tcaggcatgggagtcattgtccacatcattgagaaggacaaaatcaccacgaggacactg aaggcccgcatggactaa

DBGET integrated database retrieval system