Bos taurus (cow): 537330 Help Entry 537330            CDS       T01008                                  Symbol WNT10A Name (RefSeq) protein Wnt-10a precursor   KO K01357   wingless-type MMTV integration site family, member 10 Organism bta  Bos taurus (cow) Pathway bta04150   mTOR signaling pathway bta04310   Wnt signaling pathway bta04390   Hippo signaling pathway bta04550   Signaling pathways regulating pluripotency of stem cells bta04916   Melanogenesis bta04934   Cushing syndrome bta05010   Alzheimer disease bta05022   Pathways of neurodegeneration - multiple diseases bta05165   Human papillomavirus infection bta05200   Pathways in cancer bta05205   Proteoglycans in cancer bta05217   Basal cell carcinoma bta05224   Breast cancer bta05225   Hepatocellular carcinoma bta05226   Gastric cancer Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     537330 (WNT10A)    04390 Hippo signaling pathway     537330 (WNT10A)    04150 mTOR signaling pathway     537330 (WNT10A)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     537330 (WNT10A)  09150 Organismal Systems   09152 Endocrine system    04916 Melanogenesis     537330 (WNT10A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     537330 (WNT10A)    05205 Proteoglycans in cancer     537330 (WNT10A)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     537330 (WNT10A)    05226 Gastric cancer     537330 (WNT10A)    05217 Basal cell carcinoma     537330 (WNT10A)    05224 Breast cancer     537330 (WNT10A)   09172 Infectious disease: viral    05165 Human papillomavirus infection     537330 (WNT10A)   09164 Neurodegenerative disease    05010 Alzheimer disease     537330 (WNT10A)    05022 Pathways of neurodegeneration - multiple diseases     537330 (WNT10A)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     537330 (WNT10A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    00536 Glycosaminoglycan binding proteins [BR:bta00536]     537330 (WNT10A) Glycosaminoglycan binding proteins [BR:bta00536]  Heparan sulfate / Heparin   Morphogens    537330 (WNT10A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  wnt DUF6973 DUF7539 Motif Other DBs NCBI-GeneID:  537330 NCBI-ProteinID:  NP_001092548 Ensembl:  ENSBTAG00000009217 VGNC:  36954 UniProt:  A6H6Z9 LinkDB All DBs Position 2:106841901..106855595 Genome browser AA seq 266 aa AA seqDB search MGSTHPCPWLRLRPRPQPRPALCALLFFLLLLAASVPRSAPNDILGLRLPQEPVLNANTV CLTLPGLSKRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES PIFSRGFRESAFAYAISAAGVVHAVSNACALGKLRACGCDASRRGDEEAFRRKLHRLQLE ALQRGKGLSHGVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA RMRLHNNRVGRQVSAPPRWAGSDPFA NT seq 801 nt NT seq  +upstreamnt  +downstreamnt atgggcagcactcacccttgcccctggctgcggctccgacctcggccccagccgcggccc gcgctctgcgctctcctcttcttcctactgctgctggctgcctccgtgcccaggtctgca cccaacgatatcctgggcctccgcctcccccaggagcccgtgctcaacgccaacacggtg tgcctgacattgccaggcctgagcaagcggcagatggaggtgtgtgtgcgccaccctgac gtggctgcttcagccatccagggcatccagattgccatccatgagtgccagcaccagttc cgggatcagcgctggaattgctctagtctggagactcgaaacaagatcccttatgagagt cccatcttcagcagaggtttccgagaaagtgcattcgcctacgccatctcggcagccggc gtggtgcacgcggtatccaacgcctgcgccctgggcaaactgagggcctgcggctgcgac gcatcccggcgtggcgacgaggaggccttccgtcggaagttgcaccgcctgcagctggaa gcgctgcagcgcggcaagggcctgagccacggagttcccgagcaccctgccctgcccccg gccagccccggcctgcaggactcctgggagtggggcggctgcagccctgacgtgggtttt ggagagcgcttctctaaagactttctggactcccgggaacctcacagagacatccatgcg cgcatgaggctccacaacaaccgagtagggaggcaggtgagcgccccaccccgctgggcc ggctcagacccctttgcctag

DBGET integrated database retrieval system