Bos taurus (cow): 539034 Help Entry 539034            CDS       T01008                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism bta  Bos taurus (cow) Pathway bta04015   Rap1 signaling pathway bta04810   Regulation of actin cytoskeleton bta05014   Amyotrophic lateral sclerosis bta05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     539034 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     539034 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     539034 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     539034 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     539034 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bta04812]     539034 (PFN2)    04147 Exosome [BR:bta04147]     539034 (PFN2) Membrane trafficking [BR:bta04131]  Others   Actin-binding proteins    Others     539034 (PFN2) Cytoskeleton proteins [BR:bta04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      539034 (PFN2) Exosome [BR:bta04147]  Exosomal proteins   Proteins found in most exosomes    539034 (PFN2) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  539034 NCBI-ProteinID:  NP_001121669 Ensembl:  ENSBTAG00000011150 VGNC:  32776 UniProt:  Q09430 LinkDB All DBs Position 1 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaatggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtg gacggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacgtacaac gtggccgtgggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system