Bos taurus (cow): 539235 Help Entry 539235            CDS       T01008                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism bta  Bos taurus (cow) Pathway bta03008   Ribosome biogenesis in eukaryotes bta03083   Polycomb repressive complex bta04064   NF-kappa B signaling pathway bta04137   Mitophagy - animal bta04310   Wnt signaling pathway bta04520   Adherens junction bta05010   Alzheimer disease bta05020   Prion disease bta05022   Pathways of neurodegeneration - multiple diseases bta05162   Measles bta05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bta00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     539235 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     539235 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     539235 (CSNK2B)    04064 NF-kappa B signaling pathway     539235 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     539235 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     539235 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     539235 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     539235 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     539235 (CSNK2B)    05020 Prion disease     539235 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     539235 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:bta03009]     539235 (CSNK2B)    03036 Chromosome and associated proteins [BR:bta03036]     539235 (CSNK2B) Ribosome biogenesis [BR:bta03009]  Eukaryotic type   90S particles    Kinase     539235 (CSNK2B) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      539235 (CSNK2B) SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  539235 NCBI-ProteinID:  NP_001039919 BGD-bta:  BT11665 Ensembl:  ENSBTAG00000008837 VGNC:  53965 UniProt:  P67868 N0E640 LinkDB All DBs Position 23 Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggcaatgaa ttcttctgtgaggtggatgaagactatatccaggacaaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctttagacatgatcttggacctggagcctgatgag gagctggaggacaaccccaaccagagtgacctgattgagcaagcagctgaaatgctctat ggattgatccacgcccgctatatcctcaccaaccgtggcattgcccagatgttggaaaag taccagcagggagactttggatactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccaccacacggatggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagaggcccgcc aaccagtttgtgcccaggctttacggtttcaagatccatccaatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtgaagacgattcgctga

DBGET integrated database retrieval system