Bos taurus (cow): 539277 Help Entry 539277            CDS       T01008                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism bta  Bos taurus (cow) Pathway bta04014   Ras signaling pathway bta04015   Rap1 signaling pathway bta04020   Calcium signaling pathway bta04022   cGMP-PKG signaling pathway bta04024   cAMP signaling pathway bta04070   Phosphatidylinositol signaling system bta04114   Oocyte meiosis bta04218   Cellular senescence bta04261   Adrenergic signaling in cardiomyocytes bta04270   Vascular smooth muscle contraction bta04371   Apelin signaling pathway bta04625   C-type lectin receptor signaling pathway bta04713   Circadian entrainment bta04720   Long-term potentiation bta04722   Neurotrophin signaling pathway bta04728   Dopaminergic synapse bta04740   Olfactory transduction bta04744   Phototransduction bta04750   Inflammatory mediator regulation of TRP channels bta04910   Insulin signaling pathway bta04912   GnRH signaling pathway bta04915   Estrogen signaling pathway bta04916   Melanogenesis bta04921   Oxytocin signaling pathway bta04922   Glucagon signaling pathway bta04924   Renin secretion bta04925   Aldosterone synthesis and secretion bta04970   Salivary secretion bta04971   Gastric acid secretion bta05010   Alzheimer disease bta05012   Parkinson disease bta05022   Pathways of neurodegeneration - multiple diseases bta05031   Amphetamine addiction bta05034   Alcoholism bta05133   Pertussis bta05152   Tuberculosis bta05163   Human cytomegalovirus infection bta05167   Kaposi sarcoma-associated herpesvirus infection bta05170   Human immunodeficiency virus 1 infection bta05200   Pathways in cancer bta05214   Glioma bta05417   Lipid and atherosclerosis bta05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     539277 (CALML4)    04015 Rap1 signaling pathway     539277 (CALML4)    04070 Phosphatidylinositol signaling system     539277 (CALML4)    04024 cAMP signaling pathway     539277 (CALML4)    04022 cGMP-PKG signaling pathway     539277 (CALML4)  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     539277 (CALML4)    04915 Estrogen signaling pathway     539277 (CALML4)    04921 Oxytocin signaling pathway     539277 (CALML4)    04924 Renin secretion     539277 (CALML4)    04925 Aldosterone synthesis and secretion     539277 (CALML4)   09154 Digestive system    04970 Salivary secretion     539277 (CALML4)    04971 Gastric acid secretion     539277 (CALML4)   09156 Nervous system    04728 Dopaminergic synapse     539277 (CALML4)    04720 Long-term potentiation     539277 (CALML4)    04722 Neurotrophin signaling pathway     539277 (CALML4)   09157 Sensory system    04740 Olfactory transduction     539277 (CALML4)    04750 Inflammatory mediator regulation of TRP channels     539277 (CALML4)   09159 Environmental adaptation    04713 Circadian entrainment     539277 (CALML4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     539277 (CALML4)   09162 Cancer: specific types    05214 Glioma     539277 (CALML4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     539277 (CALML4)    05163 Human cytomegalovirus infection     539277 (CALML4)    05167 Kaposi sarcoma-associated herpesvirus infection     539277 (CALML4)   09171 Infectious disease: bacterial    05133 Pertussis     539277 (CALML4)    05152 Tuberculosis     539277 (CALML4)   09164 Neurodegenerative disease    05010 Alzheimer disease     539277 (CALML4)    05012 Parkinson disease     539277 (CALML4)    05022 Pathways of neurodegeneration - multiple diseases     539277 (CALML4)   09165 Substance dependence    05031 Amphetamine addiction     539277 (CALML4)    05034 Alcoholism     539277 (CALML4)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     539277 (CALML4)    05418 Fluid shear stress and atherosclerosis     539277 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bta01009]     539277 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     539277 (CALML4)    03036 Chromosome and associated proteins [BR:bta03036]     539277 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     539277 (CALML4) Protein phosphatases and associated proteins [BR:bta01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      539277 (CALML4) Membrane trafficking [BR:bta04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     539277 (CALML4) Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      539277 (CALML4) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    539277 (CALML4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 EF-hand_8 AIF-1 EH GPHH EF-hand_11 Motif Other DBs NCBI-GeneID:  539277 NCBI-ProteinID:  NP_001029843 BGD-bta:  BT24964 VGNC:  26713 UniProt:  Q3T0E8 LinkDB All DBs Position 10:complement(15035517..15044869) Genome browser AA seq 153 aa AA seqDB search MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLLTVMRCLGASPTPGEAQRHLQTHRIDR NGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMQLGEKLTHK EVEDLFREAGIEPNGKVKYDEFIQKLTIPVRDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaagtttctttcccaggaccaaattaatgagtacaaagaatgcttctccctgtac gacaagcagcagcgggggaagattaaagccacggaccttctgacggtgatgcggtgcctg ggggccagcccaacgcctggggaggctcagcggcacctacagactcacaggatagacaga aatggagagctggatttctctactttcctgaccatcatgcatatgcaaataaaacaagag gacccaaagaaggaaattcttttggccatgttgatggcggacaaggagaagaaaggctac atcatggcgtctgaactgcgctcaaaactcatgcaactgggggagaagctcacccacaaa gaagtggaggatctcttcagggaagcaggtattgaaccgaatggcaaagtgaagtatgac gagttcatccagaagctcaccattcctgtgcgggactactga

DBGET integrated database retrieval system