Bos taurus (cow): 539764 Help Entry 539764            CDS       T01008                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism bta  Bos taurus (cow) Pathway bta04014   Ras signaling pathway bta04137   Mitophagy - animal bta04144   Endocytosis bta04145   Phagosome bta04148   Efferocytosis bta04962   Vasopressin-regulated water reabsorption bta05014   Amyotrophic lateral sclerosis bta05022   Pathways of neurodegeneration - multiple diseases bta05132   Salmonella infection bta05146   Amoebiasis bta05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bta00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     539764 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     539764 (RAB5A)    04145 Phagosome     539764 (RAB5A)    04137 Mitophagy - animal     539764 (RAB5A)    04148 Efferocytosis     539764 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     539764 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     539764 (RAB5A)    05152 Tuberculosis     539764 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     539764 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     539764 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     539764 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bta04131]     539764 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     539764 (RAB5A)    04031 GTP-binding proteins [BR:bta04031]     539764 (RAB5A) Membrane trafficking [BR:bta04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     539764 (RAB5A)  Endosome - Lysosome transport     539764 (RAB5A) Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    539764 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    539764 (RAB5A)   Exosomal proteins of colorectal cancer cells    539764 (RAB5A)   Exosomal proteins of bladder cancer cells    539764 (RAB5A) GTP-binding proteins [BR:bta04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     539764 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  539764 NCBI-ProteinID:  NP_001069654 BGD-bta:  BT12715 Ensembl:  ENSBTAG00000046385 VGNC:  33658 UniProt:  Q0IIG7 LinkDB All DBs Position 1:157198540..157232078 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSTRGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagccttgtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccattggggctgcttttctaactcaa acggtatgtcttgatgacacgacagtaaaatttgaaatatgggatacggctggccaagag cggtaccacagcctggcgcccatgtactacagaggcgcccaggccgccatagtcgtgtac gacatcacgaacgaggagtcctttgccagagccaaaaactgggttaaagagcttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggccgatctggcaaataaa agagctgtcgactttcaggaggcacagtcctatgcggatgataacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggagcaaattctaccagaggaagaggagtagac ctcaccgagcccacacagcccaccaggagtcagtgctgtagtaactaa

DBGET integrated database retrieval system