Bos taurus (cow): 540092 Help Entry 540092            CDS       T01008                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism bta  Bos taurus (cow) Pathway bta04810   Regulation of actin cytoskeleton bta05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bta00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     540092 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     540092 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  540092 NCBI-ProteinID:  NP_001107982 Ensembl:  ENSBTAG00000016098 VGNC:  26570 UniProt:  A8YXX8 LinkDB All DBs Position 22:complement(16724647..16732199) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggacaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgggag tacattgaggtcatcaccagcagcatcaagaaaatcgcagactttctcaactcattcgat atgtcttgtcgctcaagactcgcaacactaaatgagaaattgacagctcttgagcggaga atagagtacatagaagccagggtgacaaaaggtgaaaccctcacctag

DBGET integrated database retrieval system